SecReT4
Protein ID: 120609422
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0726
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]780342..781391 [+]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDA1TK38
KEGG IDaav:Aave_0726
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.8e-82, Aligned region: 33..299
TrwB_AAD_bind [PF10412], Evalue: 2.3e-06, Aligned region: 155..192
FtsK_SpoIIIE [PF01580], Evalue: 6.7e-06, Aligned region: 149..222
AAA_30 [PF13604], Evalue: 7.5e-05, Aligned region: 142..191
Protein Sequence: 349 a.a.     [Download]
>gi|120609422|ref|YP_969100.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSAVPQIPPQPRSSAAASQDRRIQMLRTAMGPVIAAALEDPDVVEVMLNPDRTLWVDRLSSGRAPLGVEL
PEADGERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKRAVSIIGLDRYVADG
ILTAGQAEFLRHAVRERQNILIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTIELQCAARDHVPLRTR
AGVVSMQELVRATMRLRPDRVIVGEVRGGEALDLVKVWGTGHPGGIATIHAGSALGALLRLEQLVLEVAV
NPPRALIAEAVNVVIHIAGRGRKRHVETISRVVGFDGAGYRLADALKTPFPELPPVPSPSLDQSSGELP
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|120608714|ref|NC_008752.1|:780342-781391 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAGTGCCGTTCCACAGATCCCGCCCCAACCACGCTCATCCGCTGCGGCGTCCCAGGATCGCCGAATCC
AGATGCTGCGCACGGCGATGGGCCCGGTGATCGCTGCTGCGCTGGAAGACCCGGACGTGGTGGAAGTGAT
GCTCAACCCCGACCGGACATTGTGGGTGGATCGGCTGTCCTCTGGACGTGCACCGCTCGGAGTCGAACTG
CCCGAGGCCGATGGCGAACGCATCATCCGCCTGGTAGCCGCCCATGTTGGTGCGGAGGTGCATCGCGGCC
AACCGCTCTTGACCGCCGAACTGCCGGAGACCGGCGAACGCTTCGAGGGCATCTTGCCGCCCGCCGCCCC
CGGCCCGGCCTTTGCGCTGCGCAAACGCGCCGTGAGCATCATCGGTCTGGATCGCTATGTGGCCGATGGC
ATCCTGACCGCTGGGCAGGCCGAGTTTCTGCGTCATGCAGTGCGCGAGCGGCAGAACATCCTGATTGCTG
GTGGCACCAGTACCGGCAAGACCACGCTGGCGAACGCGCTGCTGGCCGAGATCGCCGCTACCGGCGACCG
CGTGTTGGTGCTCGAAGACACCATCGAGCTGCAATGCGCGGCGCGTGACCACGTGCCGCTGCGCACCCGC
GCAGGCGTGGTGTCGATGCAGGAGCTTGTGCGCGCCACGATGCGGCTGCGCCCGGATCGCGTGATCGTGG
GCGAAGTGCGCGGCGGCGAAGCGCTGGATCTGGTGAAGGTCTGGGGCACCGGCCACCCCGGTGGCATCGC
CACCATCCATGCCGGTTCCGCCTTGGGCGCACTGCTGCGCCTCGAACAGTTGGTTCTCGAAGTAGCGGTG
AATCCGCCGCGTGCGCTGATCGCCGAGGCGGTCAACGTCGTCATCCACATCGCAGGCCGTGGCCGCAAGC
GCCACGTCGAAACCATTTCTCGCGTCGTCGGTTTCGACGGCGCGGGCTACCGCCTGGCGGATGCGCTGAA
AACGCCATTTCCCGAGCTGCCGCCGGTTCCTTCCCCGTCCCTCGACCAATCCTCTGGAGAACTGCCATGA
 Primer design