SecReT4
Protein ID: 120609423
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0727
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]781388..781774 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA1TK39
KEGG IDaav:Aave_0727
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.2e-24, Aligned region: 33..118
Protein Sequence: 128 a.a.     [Download]
>gi|120609423|ref|YP_969101.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MTHVDAFRLSVNPLSWRPSLARLHRLARPAGQGLLLEALLLLLAGTAQAAGSSMPWEGPLQSILESIQGP
VARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|120608714|ref|NC_008752.1|:781388-781774 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGACGCACGTTGATGCTTTCCGTCTTTCTGTAAATCCGCTTTCTTGGCGGCCCTCGCTGGCACGGCTGC
ACCGCCTGGCCCGACCCGCAGGGCAAGGGCTGCTGCTGGAGGCGCTGCTGCTGTTGCTGGCCGGTACGGC
GCAGGCCGCCGGTTCCTCGATGCCGTGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAGGGGCCG
GTGGCCCGCATCGTCGCGGTCATCATCATTATTGCGACGGGCCTGGCGCTGGCCTTCGGCGATACCAGTG
GCGGCTTTCGCAAGCTGATCCAGATCGTCTTCGGCCTGTCCATCGCCTTCGCGGCTTCGAGCTTCTTCCT
CTCGTTCTTCAGCTTCTCCGGCGGGGCCGTCGTATGA
 Primer design