SecReT4
Protein ID: 120609424
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0728
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]781771..782040 [+]
Productputative conjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDA1TK40
KEGG IDaav:Aave_0728
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.9e-11, Aligned region: 1..82
Protein Sequence: 89 a.a.     [Download]
>gi|120609424|ref|YP_969102.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSKATDLPGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIAGHSLAVWGARVD
PQFMQVFARHIKHKPLLDV
 
Nucleotide Sequence: 270 bp     [Download]
>gi|120608714|ref|NC_008752.1|:781771-782040 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAGCAAGGCCACTGATCTTCCGGGCTTTGAAGTGCCGCTGCATCGCTCGCTGACCGAGCCGATCCTGC
TGGGCGGTGCGCCGCGCACCGTGGCGATTGCCAACGGCACGCTGGCCGCCGCCGTCGGGCTGGGCCTGCA
ACTGTGGATTCCCGGCGTGGTGCTGTGGATCGCCGGCCATTCGCTGGCGGTGTGGGGTGCTCGTGTCGAT
CCGCAGTTCATGCAGGTCTTCGCTCGGCACATCAAGCACAAGCCGCTACTGGACGTATAG
 Primer design