SecReT4
Protein ID: 120609425
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0729
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]782053..784503 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA1TK41
KEGG IDaav:Aave_0729
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.3e-36, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 1e-15, Aligned region: 299..388
DUF853 [PF05872], Evalue: 9.5e-08, Aligned region: 596..684
Protein Sequence: 816 a.a.     [Download]
>gi|120609425|ref|YP_969103.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MLNLAEYHQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRAAAGYPRSDFPEPLSWLVEEERRAAFEESGHHYESAYHLTLAYLPPEESRARAAKMLY
ENAPGDGVDWQGRLEAFVAETDRVFDLLDGVKPEIAWLDDAQTLTYLHATVSTRRYRVGVPDVPFHIDAL
LADSALVGGLAPMLGDRHLRVVSVRGFPTSTWPGILDDLNRLGFGYRWSTRFLCLDKAEAEKELGRLRRQ
WFAKRKNVVALLRETIFQQESPLVDTDANNKAADADAALQELGSDQVAFGYLTATVAVMDADAAVADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHLMPVSAVWAGPEKNAHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYPGSRIFAFDMGRSMRATILGLG
GEHYDLGNDGAIAFQPLARIDQEGYRTWAAEWVEGRLLHEGVAIGPDEKAAIWSALGSLAGAPVGQRTLT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADADRLGSGSVQGFEMEELMHSKAAVLAVLGYLFARFDERF
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAVIESCASRIFLPN
PQATEPHIRTIYEGFGLNARQIEIVATAQPKRDYYYQSRMGNRLFDLDLGPATLAFAGASTPQDQRDIDR
VLLDAGTPGFAGAWLRHRGLDWAADLLPSSPAAASFLASQRPEVSP
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|120608714|ref|NC_008752.1|:782053-784503 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCTGAACCTTGCCGAATACCACCAGCGGCCCGCGCTGCTGGCCGACTGGTTGCCCTGGGCCGGGCTGA
TCGCGCCGGGCGTGGTACTGAACAAGGATGGCTCGTTCCAGCGCACGGCACGTTTTCGTGGGCCGGATCT
GGACAGCGCGACGCAAGGCGAGCTGATCGCCACGTCGGCGCGGCTCAACAACGCGCTGCGTCGCCTGGGA
TCGGGCTGGGCCTTGTTTATCGAAGCTGAGCGCCGCGCAGCGGCGGGCTATCCACGTTCCGACTTCCCCG
AACCGTTGTCCTGGCTGGTGGAGGAAGAACGCCGCGCGGCTTTCGAGGAATCCGGCCATCACTACGAGAG
CGCCTATCACCTCACGCTGGCATATCTGCCACCAGAAGAATCCCGCGCCCGCGCTGCCAAGATGCTCTAT
GAGAACGCGCCGGGCGACGGTGTGGACTGGCAGGGTCGGCTGGAAGCCTTCGTGGCTGAAACGGATCGAG
TGTTCGACCTGCTCGACGGCGTCAAGCCAGAGATTGCCTGGCTGGATGACGCGCAGACACTGACCTACCT
GCACGCCACGGTGTCCACGCGGCGCTACCGCGTCGGCGTGCCCGACGTGCCATTCCACATCGACGCGCTG
CTGGCCGATTCCGCCCTGGTCGGTGGCCTGGCTCCCATGCTGGGCGACCGGCATCTACGCGTGGTGTCGG
TGCGAGGATTTCCGACCTCAACCTGGCCGGGGATTCTGGACGACCTCAACCGCTTGGGCTTCGGCTACCG
CTGGAGCACGCGCTTTTTGTGCCTGGACAAAGCCGAGGCGGAAAAAGAACTGGGCCGTCTGCGCCGCCAG
TGGTTCGCCAAGCGCAAGAACGTCGTCGCGCTGCTGCGCGAAACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCCAACAACAAAGCCGCCGATGCGGATGCCGCCTTGCAGGAGCTGGGCAGCGATCAAGT
TGCCTTCGGCTACCTGACGGCCACCGTCGCCGTCATGGATGCCGATGCCGCCGTGGCCGACGAGAAGCTG
CGGATGGTGGAGCGCGTCATCCAGGGGCGCGGCTTCGTCACCATCCCCGAAACCTTAAACGCCGTGGATG
CCTGGCTGTCGTCCATTCCCGGCAACGCCTATGCCAACGTGCGCCAGCCCATCGTCTCGACGCTGAATCT
GGCGCACCTGATGCCGGTGTCTGCCGTTTGGGCCGGGCCGGAGAAGAACGCGCATCTGGATGGCCCGCCG
CTGATCGTCACCCGCACCGATGGCGCGACGCCGTTCCGGCTGGTGACGCATATCGGCGACGTGGGCCACA
CGCTGGTTGCCGGGCCGACCGGCATGGGCAAGTCGGTCTTGCTCGCCACGCTGGCAATGCAGTTTCGCCG
CTATCCCGGCTCGCGCATCTTCGCCTTCGACATGGGCCGCTCGATGCGCGCCACCATCCTGGGGCTGGGC
GGCGAGCATTACGACCTCGGCAACGATGGGGCGATCGCCTTCCAGCCACTGGCCCGCATCGACCAGGAGG
GCTACCGCACCTGGGCCGCTGAGTGGGTGGAAGGTCGCCTGCTGCATGAAGGTGTTGCCATCGGCCCGGA
CGAGAAGGCCGCGATCTGGTCAGCACTCGGCAGCCTCGCTGGTGCGCCGGTCGGGCAGCGCACGCTGACG
GGTCTGTCGGTGCTGTTGCAGTCGAACGCACTGCGCCAGGCGCTCGCGCCCTATGTGCTGGGTGGTGCCC
ACGGCAAGCTGCTGGATGCCGATGCCGACCGCCTGGGTTCCGGCAGCGTGCAGGGCTTCGAGATGGAAGA
ACTGATGCACAGCAAAGCGGCGGTGCTGGCCGTGCTGGGCTACCTGTTCGCCCGCTTCGATGAACGCTTC
GACGGCGCGCCCACGCTGCTGATCCTCGATGAAGCCTGGTTGTTTCTCGATGACCCGGTGTTCGCCGCCC
GCATCCGCCAGTGGCTCAAGACACTGCGCAAGAAAAACGTCAGTGTCATCTTCGCCACGCAATCGTTGGC
TGACATCAAGGATTCGAGCATTGCCCCGGCGGTGATCGAAAGCTGCGCGAGTCGCATTTTCCTCCCCAAT
CCGCAGGCCACAGAGCCGCATATCCGCACGATCTACGAAGGCTTCGGGCTGAACGCGCGCCAGATCGAGA
TCGTGGCGACCGCGCAGCCCAAGCGTGACTACTACTACCAATCGCGCATGGGCAATCGTCTGTTCGACCT
CGACCTGGGGCCAGCCACGTTGGCTTTCGCCGGGGCATCCACCCCACAAGACCAACGCGATATAGATCGC
GTGCTGTTGGACGCAGGCACACCGGGCTTCGCCGGTGCGTGGCTGCGCCATCGTGGCCTCGATTGGGCCG
CTGATCTGCTGCCGTCCTCGCCGGCGGCAGCTTCTTTCCTCGCTTCTCAACGACCGGAGGTTTCACCATG
A
 Primer design