SecReT4
Protein ID: 120609426
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0730
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]784500..785243 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA1TK42
KEGG IDaav:Aave_0730
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 247 a.a.     [Download]
>gi|120609426|ref|YP_969104.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MKTQFRLLSVSLAAVLSVSLLASQPASALTVFDPSNFVQNTLTAVRTLEQINNQINQLQNEAQMLMNQAR
NLANLDFNIVNRLRSTLATTERLIAEARGLAYDVQSMDSTFARLYPEQYAATVSGDQMLRDAQERWKNTL
NGLHTAMRMQAQVSQNLAQDESALSDLVSQSQSATGALQAMQATNQLLALQAKQSIQAQQLQITQERAAA
LELARQAAAVERGREVTRRFLGDGTPYTPQRVDFYGN
 
Nucleotide Sequence: 744 bp     [Download]
>gi|120608714|ref|NC_008752.1|:784500-785243 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAAGACCCAATTCCGTTTGCTGTCCGTCTCGCTCGCCGCCGTGCTGTCGGTATCGCTGCTGGCCTCAC
AACCTGCGTCCGCGCTGACGGTGTTCGACCCGTCCAACTTCGTGCAGAACACGCTGACCGCCGTGCGCAC
GCTGGAGCAGATCAACAACCAGATCAACCAGCTTCAGAACGAAGCGCAGATGCTGATGAACCAGGCGCGC
AATCTGGCGAATCTGGACTTCAACATCGTCAATCGCCTGCGTTCGACGCTGGCGACCACCGAACGCCTGA
TCGCCGAGGCGCGCGGCCTGGCCTACGACGTGCAGAGCATGGATTCCACCTTCGCCCGGCTGTACCCGGA
GCAGTACGCCGCGACCGTCAGCGGCGACCAGATGCTGCGCGACGCGCAGGAACGCTGGAAGAACACCTTG
AATGGTCTGCATACCGCGATGCGGATGCAGGCGCAGGTGTCGCAGAACCTGGCCCAAGACGAAAGCGCAC
TGTCCGATCTGGTCAGCCAGAGTCAGTCCGCCACCGGCGCGCTGCAAGCCATGCAGGCGACCAACCAGCT
TCTGGCCTTGCAGGCCAAGCAGTCCATCCAGGCGCAGCAGCTCCAGATCACGCAGGAACGCGCCGCCGCG
CTGGAACTGGCACGCCAAGCGGCGGCAGTCGAACGTGGCCGTGAAGTGACGCGCCGCTTCCTGGGTGATG
GCACGCCCTACACGCCGCAGCGCGTGGATTTCTACGGTAACTGA
 Primer design