SecReT4
Protein ID: 120609428
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0732
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]785567..786958 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA1TK44
KEGG IDaav:Aave_0732
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.3e-49, Aligned region: 37..264
Protein Sequence: 463 a.a.     [Download]
>gi|120609428|ref|YP_969106.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MNDVTVIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSHATGQGDDVIAKLLRKVLY
VGAFAYIINNFNWLASIVFRSFAGLGLTASGSTMSMGEFLQPGRLAKTGIDAAAPILEQISDMAGFPEVF
VNMTPIVVMFLAWAVVILCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVHPTEPSIDHAVVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGVAGAAVAVGAAATGVGGAVMAGARMAPAAAKLAGAGARAATSAAGGAKSAFQAGSAAAGGGAKGAMAG
LGNVAKGGAQVAGQRAGAGIRAAAAKTAAPFKAGWQGSGTDGGSGGGAASSGQATTDDAAGNTANAQKQE
QPGWAKRLQRRQQLTQATATVAHTLRGGDGGGSGQGPSLRPDE
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|120608714|ref|NC_008752.1|:785567-786958 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAATGACGTGACAGTGATCGACCGCTTCCTCGATACCTTCTCGCGCTACATCGACTCGGGCTTTGGGC
TGCTGCAGGGCGAAGTCGCGTTCCTCACCGCCACGCTGATCGTCATCGACATGACCATCGCCGGGCTGTA
CTGGGCGATGAGCCACGCCACCGGCCAGGGCGATGATGTGATCGCTAAACTGCTGCGCAAGGTGCTTTAC
GTCGGCGCCTTCGCCTACATCATCAACAACTTCAACTGGCTCGCCAGCATCGTCTTCCGCTCGTTCGCGG
GCCTGGGCCTGACGGCCAGCGGCTCGACGATGAGCATGGGCGAATTCCTGCAACCGGGACGCTTGGCCAA
GACCGGCATCGACGCGGCGGCCCCCATTCTTGAGCAGATCAGCGACATGGCGGGCTTCCCCGAAGTGTTC
GTGAACATGACGCCCATCGTGGTCATGTTCCTGGCCTGGGCGGTGGTGATCCTGTGTTTCTTCGTGCTGG
CGATCCAGCTTTTCATTACGCTGATCGAGTTCAAGCTGACCACGCTTGCAGGCTTCGTACTGGTGCCGTT
CGCTCTGTGGAACAAAACCAGCTTCCTCGCCGAAAAGGTGCTGGGCAACGTGGTGTCCTCGGGCATCAAG
GTGCTGGTGCTGGCCGTCATCGTTGGCATTGGCTCGGGCCTGTTTGCCGAGTTTCAGGTGCATCCCACCG
AGCCGTCCATCGACCATGCGGTGGTCATCATGCTGGCCTCGCTCACGCTGCTGGCGTTGGGGATCTTCGG
CCCTGGCATTGCCACCGGGCTGGTATCCGGCGCACCGCAGTTGGGTGCCGGGGCGATGGCCGGTGCTGCT
GTGGGTGTCGCAGGCGCGGCGGTTGCCGTGGGTGCTGCGGCCACCGGCGTGGGCGGTGCCGTGATGGCCG
GAGCGCGCATGGCACCGGCTGCTGCCAAGCTCGCCGGGGCTGGCGCGCGGGCCGCGACCTCGGCGGCTGG
TGGTGCGAAGTCGGCCTTCCAAGCTGGTTCCGCCGCAGCGGGTGGCGGGGCCAAGGGCGCGATGGCAGGG
CTGGGCAATGTCGCCAAGGGTGGCGCACAGGTGGCAGGCCAACGCGCGGGTGCTGGCATCAGAGCAGCCG
CTGCCAAGACTGCCGCGCCATTCAAAGCAGGCTGGCAAGGCTCCGGCACCGATGGTGGTTCAGGCGGTGG
CGCTGCCAGTTCCGGGCAGGCCACCACAGACGATGCCGCCGGCAACACGGCCAATGCGCAGAAGCAGGAG
CAACCCGGCTGGGCCAAGCGCCTGCAACGCCGCCAACAACTCACCCAGGCCACCGCCACGGTCGCGCACA
CGCTGCGCGGTGGCGACGGCGGCGGTTCGGGCCAAGGCCCGAGCCTGCGCCCCGATGAATGA
 Primer design