SecReT4
Protein ID: 120609429
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0733
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]786988..787692 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA1TK45
KEGG IDaav:Aave_0733
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.5e-59, Aligned region: 22..225
Protein Sequence: 234 a.a.     [Download]
>gi|120609429|ref|YP_969107.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MRFKRPQVRYADTPQPATPYQAAAQVWDERIGSARVQAKNWRLMAFGCLVLALLMAGGLVWRSAQSIVTP
YVIEVDQSGQVRTVGEAATPYRPTDAQTAHHIARFLTLVRSLSIDPIVVRQNWLDAYDYTTDRGAAVLND
YARVNDPFARIGKESVTVQITSVVRASDASFNVRWTERRYVNGAAAGLERWTAVVSIVQQTPRTEERLRR
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|120608714|ref|NC_008752.1|:786988-787692 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCGATTCAAACGACCGCAGGTGCGCTATGCCGATACGCCGCAGCCTGCCACTCCGTATCAAGCCGCTG
CCCAGGTCTGGGACGAGCGCATCGGCTCGGCCCGCGTGCAGGCCAAGAACTGGCGGCTGATGGCCTTCGG
CTGCCTGGTGCTCGCGCTGCTGATGGCCGGTGGCCTGGTGTGGCGATCGGCACAGTCCATCGTCACGCCC
TACGTCATCGAGGTGGATCAGTCCGGCCAGGTGCGCACCGTGGGCGAAGCTGCCACGCCGTACCGGCCCA
CCGATGCGCAGACCGCGCACCACATCGCGCGCTTCCTGACGCTGGTGCGCTCGCTGTCCATCGACCCCAT
CGTCGTGCGGCAGAACTGGCTGGATGCCTACGACTACACCACCGATCGGGGCGCGGCGGTGCTCAACGAC
TATGCGCGGGTGAATGACCCGTTCGCCCGCATCGGCAAGGAGTCGGTGACGGTGCAGATCACCAGTGTGG
TTCGCGCCAGCGATGCGTCGTTCAACGTGCGCTGGACGGAACGCCGCTACGTCAATGGCGCGGCGGCCGG
GCTGGAGCGATGGACGGCGGTGGTGTCCATCGTGCAGCAGACCCCACGCACCGAAGAACGCCTGCGCCGC
AACCCGCTGGGCATTTACGTCAATGGCTTGTCGTGGAGCCGCGAGCTGGATTCTTCCGAAGGAGCCAAAC
CATGA
 Primer design