SecReT4
Protein ID: 120609430
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0734
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]787689..788693 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA1TK46
KEGG IDaav:Aave_0734
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.1e-67, Aligned region: 107..326
Protein Sequence: 334 a.a.     [Download]
>gi|120609430|ref|YP_969108.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MNARFRKTALPVILLASTVLFAGCAMQGKPPPVISLDEPVQAQPLPEPPKPIEVVAVPEPLALPAQLKPL
PDVGAAPTTPEPADEKVRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYASVGRVTVIALQPGEEL
VTVAAGDTVRWIVGDTSSGSGADLRVNVLVKPIRSGLKTNLVITTSRRTYLLELTSTDKAWMASVSWDYP
KDRMLALQRQAQAANAAAPVDAGLSLENIRFRYAISGSNPPWKPLRAFDDGEKVYIQFPAGIAQGELPPL
FVIGAQGDGQLVNYRFRSPYYIVDRLFGAAELRLGADKGDVVRIERTDGIAGRN
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|120608714|ref|NC_008752.1|:787689-788693 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAATGCACGTTTCCGTAAAACCGCATTGCCGGTGATCCTGCTGGCATCGACTGTTCTGTTTGCAGGCT
GCGCCATGCAAGGCAAACCGCCGCCGGTGATCTCGCTCGATGAGCCGGTTCAGGCGCAGCCATTGCCCGA
GCCGCCCAAACCCATCGAAGTGGTGGCCGTGCCCGAACCGTTGGCATTGCCCGCACAGTTGAAGCCGCTG
CCGGACGTTGGTGCGGCCCCGACCACGCCGGAGCCTGCCGACGAGAAGGTGCGCGTCTCCCGCGCCAATG
CCGAAGCACGGATCGCGCCGACCCGAGAGGGCTACGTCAATGCGATCCAGGTCTGGCCCTTCACCGATGG
CGCGCTCTATCAGGTCTATGCGTCCGTAGGCCGCGTAACCGTGATCGCGCTCCAACCCGGTGAGGAACTG
GTGACGGTGGCCGCAGGCGATACCGTGCGCTGGATCGTCGGTGACACCTCCAGCGGCAGCGGTGCCGATT
TGCGCGTCAATGTGCTGGTGAAACCCATCCGTTCCGGCCTCAAAACCAATCTGGTCATCACCACCAGCCG
CCGCACCTATCTGCTGGAACTGACTTCGACCGACAAGGCGTGGATGGCCTCGGTGTCCTGGGACTATCCC
AAGGATCGGATGCTGGCCTTGCAGCGCCAGGCACAGGCTGCCAACGCAGCCGCGCCGGTTGATGCGGGCC
TGTCGCTGGAGAACATCCGCTTTCGCTACGCGATCAGCGGCAGCAATCCGCCGTGGAAGCCGCTGCGGGC
TTTCGATGATGGCGAGAAGGTCTATATCCAGTTCCCGGCAGGCATCGCCCAGGGCGAGCTGCCGCCGCTG
TTCGTCATCGGTGCGCAGGGCGATGGGCAACTGGTGAACTACCGTTTCCGCTCGCCTTACTACATCGTGG
ATCGTCTGTTCGGTGCGGCAGAACTGCGCCTGGGGGCCGACAAGGGCGATGTGGTGCGCATCGAGCGCAC
GGATGGCATCGCCGGGAGGAACTGA
 Primer design