SecReT4
Protein ID: 120609431
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0735
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]788696..789835 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA1TK47
KEGG IDaav:Aave_0735
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.6e-43, Aligned region: 229..378
Protein Sequence: 379 a.a.     [Download]
>gi|120609431|ref|YP_969109.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSQDDIPDLATPQADKVAPDAVALRAQPRPVTRLNRRTLAILAGGLSVGVMGALIWSLQPQQRGAGESTE
LYNVDRVSRSEGLDALPADYSKLPVLPPDVPELGPPLPGDLGPAIVNSQQPVAATYAAPGYDPNDALRKE
AEAAAASSVFFRTGSTQAAPVAQSQVAAAPGFAANAAFDPLAAGPASTAAQPADPTAVQNRQDQKEAFLT
GGSTETRNSGNLQVPTSPYQVMAGTVIAGALVTGIKSDLPGDVIAMVTEPIYDTATGKFLLIPQGSRILG
KYNSQVSYGQSRVQVVWNRIILPDTSSLTLDNLIGTDPAGYAGLEDDVDWHSGRIFAGAVLTTLLGVGAE
LAAPENRQDGDRVIIAGRDSLQDTVNQVG
 
Nucleotide Sequence: 1140 bp     [Download]
>gi|120608714|ref|NC_008752.1|:788696-789835 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAGCCAGGACGACATTCCCGACCTTGCCACGCCGCAGGCGGACAAGGTGGCACCCGATGCGGTGGCGC
TGCGCGCCCAACCGCGCCCGGTCACGCGCCTGAACCGGCGCACGCTGGCCATCCTCGCCGGCGGCTTGTC
GGTTGGCGTGATGGGCGCGCTGATCTGGTCTCTGCAACCGCAGCAACGCGGTGCAGGCGAATCCACTGAG
CTGTACAACGTGGATCGTGTCTCGCGCTCGGAAGGGCTGGATGCGCTGCCGGCGGACTATTCCAAGCTGC
CAGTGCTGCCGCCCGACGTGCCGGAGCTGGGGCCGCCTTTACCGGGCGACCTGGGGCCAGCCATCGTCAA
TTCGCAGCAGCCGGTTGCCGCCACCTATGCCGCGCCGGGCTACGACCCTAACGATGCGCTACGCAAGGAA
GCAGAAGCGGCTGCGGCTTCATCGGTGTTCTTCCGCACTGGTTCCACACAGGCAGCGCCCGTGGCGCAGT
CGCAGGTCGCTGCCGCACCAGGCTTCGCTGCCAACGCTGCGTTCGATCCGCTGGCCGCTGGCCCGGCCTC
GACGGCGGCCCAGCCTGCTGATCCGACTGCCGTGCAGAACCGGCAAGACCAGAAAGAGGCGTTCCTAACA
GGCGGCTCTACGGAAACCCGTAACTCCGGCAACCTGCAAGTGCCTACCTCGCCGTATCAGGTGATGGCCG
GAACGGTCATTGCCGGGGCACTGGTCACGGGCATCAAGTCGGATTTGCCGGGCGACGTGATCGCCATGGT
GACGGAGCCGATCTATGACACGGCCACTGGCAAGTTCCTGCTGATCCCGCAGGGATCTCGCATCCTGGGC
AAGTACAACAGCCAGGTCAGCTACGGCCAGAGCCGCGTGCAGGTGGTGTGGAACCGCATCATCCTGCCCG
ACACGTCATCGCTCACGCTCGACAACCTGATCGGCACCGACCCCGCAGGCTATGCCGGTCTGGAAGACGA
CGTGGACTGGCATTCGGGTCGGATCTTTGCCGGTGCGGTGCTGACAACGCTGCTGGGTGTAGGAGCTGAA
CTGGCCGCACCCGAGAACCGCCAGGATGGTGATCGCGTCATCATCGCCGGGCGCGACAGCCTGCAGGACA
CCGTGAACCAGGTCGGCTAG
 Primer design