SecReT4
Protein ID: 120611416
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2752
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3024781..3026166 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA1TQT2
KEGG IDaav:Aave_2752
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 461 a.a.     [Download]
>gi|120611416|ref|YP_971094.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSPFALPRLRLRPVLVAACTAAALLAGASPASAQPVSSSSLYYRMGGGSPGGAAPNRGMMANQFSAGVRA
NYSCGRFDIGASWSSLMNGISNLGATISGAIQAGIAALPLYFLQRAQPGLYQLFQNFSQKADLLVASSLK
SCEDMEALIKAGKDPYEDYVALAKGDAWKIAASTGGNVVDAKIAINKNEVAQRAGLPWVFGTRAGGAGTA
PIQPVRDLAVAGYNLTINKTASTISTANYGSSSLASTRLVQAFKTPDDLAKWSTEVLGDQKIYLCTQDSS
CPTATSTVTATGLGPKFEQELESVLPTMRTLAEANTVGQADLVKVSAPGMAVSPQLMDAMRKLPKDVRSV
AVNRLAQEIAMHKVVDKALVARNALISGLSLPQASANGQVNSEVQTKIDRLTQYINDLMYEFRIRKEMTG
ETALAIMQNQLAAGASSNAVTGGSRADPAPVFDGRVEVPKQ
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3026166-3024781 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGTCACCCTTCGCCCTGCCGCGGCTGCGCCTGCGCCCGGTGCTCGTCGCTGCATGCACGGCCGCCGCGC
TGCTCGCCGGCGCGTCCCCCGCGTCCGCGCAGCCTGTCTCTTCGTCCAGCCTCTACTACCGCATGGGCGG
CGGATCTCCCGGCGGCGCCGCGCCCAACCGCGGAATGATGGCAAACCAGTTCAGCGCCGGCGTGCGGGCC
AACTACTCGTGCGGACGGTTCGACATCGGTGCGTCCTGGTCGTCGCTCATGAACGGCATCTCCAACCTGG
GCGCCACCATCTCCGGCGCCATCCAGGCGGGCATTGCCGCACTTCCGCTGTACTTCCTGCAGCGGGCTCA
GCCCGGGCTGTACCAACTCTTCCAGAATTTCTCGCAGAAGGCCGATCTGCTGGTGGCATCCTCGCTCAAG
TCCTGCGAGGACATGGAGGCGCTGATCAAGGCCGGCAAGGATCCCTACGAGGACTACGTGGCGTTGGCCA
AGGGCGATGCCTGGAAGATCGCTGCCTCCACCGGCGGTAACGTCGTCGATGCCAAGATCGCCATCAACAA
GAACGAGGTCGCCCAGCGCGCGGGCCTGCCCTGGGTGTTCGGAACCCGGGCAGGCGGCGCCGGCACCGCG
CCCATTCAGCCGGTGCGTGACCTGGCCGTGGCCGGCTACAACCTGACCATCAACAAGACGGCCAGCACGA
TCTCGACAGCCAACTACGGCAGTTCCTCCCTCGCGTCCACCCGCCTGGTCCAGGCGTTCAAAACGCCGGA
CGACTTGGCGAAGTGGAGCACCGAGGTCCTGGGCGATCAGAAGATCTACCTGTGCACGCAGGACTCCAGC
TGCCCGACCGCGACTTCCACGGTGACGGCCACCGGCCTGGGCCCGAAGTTCGAGCAGGAGCTCGAATCCG
TGCTTCCGACGATGCGGACGCTCGCCGAGGCGAACACGGTCGGACAGGCCGACCTGGTCAAGGTGAGCGC
CCCGGGCATGGCCGTGAGCCCGCAGCTGATGGATGCGATGCGCAAGCTGCCGAAGGATGTGCGATCCGTG
GCCGTGAACCGCCTGGCGCAGGAGATCGCCATGCATAAGGTGGTGGACAAGGCCCTGGTGGCGCGCAACG
CGCTGATTTCCGGGCTGAGCTTGCCGCAGGCGAGCGCAAACGGCCAGGTCAACAGCGAGGTGCAGACCAA
GATCGACCGCCTGACCCAGTACATCAATGACCTCATGTACGAGTTCCGGATCCGCAAGGAGATGACCGGC
GAAACAGCCCTGGCGATCATGCAGAACCAACTGGCGGCAGGCGCTTCGTCCAACGCGGTCACCGGCGGCT
CGCGGGCCGATCCCGCGCCGGTCTTCGACGGCCGCGTCGAGGTTCCCAAGCAATGA
 Primer design