SecReT4
Protein ID: 120611427
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2763
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3036026..3036790 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA1TQU3
KEGG IDaav:Aave_2763
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 4.1e-59, Aligned region: 43..251
Protein Sequence: 254 a.a.     [Download]
>gi|120611427|ref|YP_971105.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MTPAPPPKPQTVGPIGLAFSVSFGLVSVAVGAWIVGMLIEIGGGYFLWKGQGIRHAQSLVQQDLEYIAAA
PRSLLVRDTVAFSLQLAGWVRMPYEKLGVLRWYQRMHAPTAAAPTAMPLTGQTVAPQLRGIGVATTDAAR
VLSEWIVISMFVAQDVLLRMAIGAFAMPAFVLACLIGVVDGLVRRDRRRWTGGRESSFVYHHAKRYTGWA
LTGGFGLYLSWPFGGFNPAHMVLVFTVLVAVTLSTTVGAFKKYA
 
Nucleotide Sequence: 765 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3036790-3036026 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGACGCCGGCACCGCCTCCCAAGCCGCAAACCGTGGGACCCATCGGGCTCGCGTTCAGCGTCTCCTTCG
GCCTCGTCAGCGTGGCCGTAGGCGCCTGGATCGTCGGCATGCTCATCGAGATCGGGGGCGGCTACTTCCT
CTGGAAGGGCCAGGGGATTCGGCACGCCCAATCTCTGGTTCAGCAGGACCTGGAGTACATCGCGGCCGCG
CCGCGCAGCCTTCTGGTGCGCGACACCGTGGCCTTCTCGCTGCAGCTTGCCGGCTGGGTGCGCATGCCCT
ACGAAAAGCTCGGCGTGCTGCGCTGGTACCAGCGCATGCATGCACCGACCGCGGCAGCGCCGACGGCAAT
GCCGCTCACCGGCCAGACGGTCGCCCCCCAGCTGCGCGGGATTGGCGTGGCCACGACGGACGCCGCGCGC
GTCCTGTCCGAATGGATCGTCATCAGCATGTTCGTGGCTCAGGACGTGCTGCTGCGCATGGCGATCGGCG
CATTCGCCATGCCGGCCTTCGTGCTGGCCTGCCTCATCGGTGTGGTCGATGGCCTGGTGCGCCGCGACCG
CCGGCGCTGGACCGGGGGCCGCGAGTCGTCCTTCGTCTACCACCACGCCAAACGCTATACCGGCTGGGCC
CTCACGGGGGGATTCGGCCTCTACCTCTCTTGGCCGTTCGGCGGCTTCAACCCCGCGCACATGGTGCTGG
TCTTCACGGTCCTGGTGGCCGTGACGCTCTCGACCACCGTGGGCGCTTTCAAAAAGTACGCATGA
 Primer design