SecReT4
Protein ID: 121582471
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4167
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]2127..5174 [-]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDA1WDE3
KEGG IDajs:Ajs_4167
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.4e-107, Aligned region: 4..464
Protein Sequence: 1015 a.a.     [Download]
>gi|121582471|ref|YP_974003.1| TraG domain-containing protein [Acidovorax sp. JS42]
MDIEIQTYWNVETLYYVFNAVASMMAGAGFAGLLKLVFLFAIAIGMFGYMNKQLEMAKWFIHALAFVTVL
NLPIARVALTDKTGLEPPRVVDNVPFALAVTAQTTNLVFGALTNTYETVFGVPEDLGLQKGDVGFGHRIL
KQVNNATIRDPSLRSDLMQFIKECTLYDVKDGEITPQQIVGGTDTWNVIFNNTSPARFVTYNTLTNAPTT
DTCTNVAAILKEKVNDAVTAGQAFYGKQAFTRASSDAIATSMFVSTVGTSYDWILNNSSNASDAMKQAMF
NNIWKEAGTELPALLNDPARVAEVNALAGAAQAARQADGSNSTLSLLAQETLPHMRNWIEAIIYGLFPVV
VVLMVVSSTEGAKKIIAGYMMSLAWIGLWPILFAVINHLSLMHLRYKARALELAAGVPFQLTDAFDATLT
NEQAAIGYMVVLVPFIAGAIIKLGQGGFMGVADRMMTGFASAGAAVGASNASGNVSMGQAGLDTASVNTT
SMNKYDSNIGLQGGGATIGRGNGSTATMAANGAVALQQLQNRMLTQMNMDHRLEAGRNQEAHRTDITSTG
DQLARRHGDSSSLTDVKGHDTTRGQYQNTGVVAARGSEGGYGGQHSTGQNLDRNFREGSHFRTAAGANDQ
LHMNLGVGRGNPSGGGAPGAGGAGGAPDPREEKRIADAMKQGGANQQQIDQALKNYRGGKGGAQPSGSLI
NAGLGYNGAKTYTAEHGRDRGVDTVHGNQEAARTERTFAERGSRTEQAGTGNQSAQNDRHGRDAALTNVD
EVSRVRDVSDRREFGTGDRANRSDSNSFTTHKDLMADPYLFEKVAARNGMTAMRFANQSEDRIMEMVQDY
VSEKGMVQQATTMPQQTFAGEKLPTTKGELEKQSAKDRAGIPQDIQGVHKKKVAQTGYGGTAPLKVDTSA
PPIIAESRGDVQGQLDPKNKGSIPARAGALDENVNAWASPDKAVGAGRANPAAVNEDNMIRDGKDTVQKA
WDKLTGGDGTADGEKLNDNMKRETAASVQINNGSK
 
Nucleotide Sequence: 3048 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c5174-2127 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
GTGGACATCGAAATTCAAACCTACTGGAACGTAGAAACGCTCTACTACGTCTTCAACGCCGTGGCCTCGA
TGATGGCCGGCGCTGGCTTCGCTGGCTTGCTGAAGCTGGTTTTCCTGTTCGCCATCGCAATCGGCATGTT
CGGCTACATGAACAAGCAGCTCGAAATGGCGAAGTGGTTTATCCACGCCCTGGCCTTTGTGACCGTGCTC
AATCTGCCGATCGCGCGCGTTGCCTTGACCGACAAGACAGGGCTGGAGCCGCCGCGCGTGGTTGATAACG
TGCCCTTTGCCCTGGCCGTCACTGCGCAGACGACCAATCTGGTGTTCGGCGCGCTGACCAACACCTATGA
AACGGTCTTCGGTGTCCCTGAAGACCTGGGCCTGCAAAAAGGGGATGTGGGCTTCGGGCACCGCATCCTG
AAACAAGTCAATAACGCGACGATCCGCGACCCCAGCTTGCGCTCCGACCTGATGCAGTTCATCAAGGAAT
GCACGCTGTACGACGTGAAAGACGGTGAAATCACCCCGCAGCAGATTGTGGGCGGCACCGATACCTGGAA
CGTGATTTTCAACAACACGAGTCCAGCCCGCTTCGTCACCTACAACACCCTGACGAATGCGCCTACCACC
GATACCTGCACCAATGTTGCGGCCATCCTGAAGGAGAAGGTCAACGACGCGGTAACGGCTGGCCAAGCCT
TCTACGGCAAGCAGGCTTTCACGCGGGCAAGCAGTGATGCTATCGCTACCAGCATGTTCGTTTCGACGGT
GGGCACGTCCTACGACTGGATTCTGAACAACTCCAGCAACGCCTCAGACGCGATGAAGCAGGCGATGTTC
AACAACATCTGGAAGGAGGCCGGCACCGAGCTGCCGGCGCTGCTGAACGATCCTGCGCGGGTGGCCGAGG
TTAATGCCCTGGCCGGCGCTGCCCAAGCGGCGCGGCAAGCGGACGGCTCCAACAGCACCTTGAGCCTGCT
GGCGCAAGAGACGCTGCCCCACATGCGCAACTGGATCGAGGCAATCATCTACGGTCTGTTCCCGGTTGTT
GTGGTGCTGATGGTTGTCAGCTCGACCGAGGGGGCAAAGAAGATCATTGCGGGCTACATGATGTCGCTGG
CCTGGATCGGCCTGTGGCCAATCTTGTTTGCCGTCATCAACCACCTGTCGCTCATGCACTTGCGCTACAA
GGCGCGCGCGCTGGAGCTGGCGGCCGGTGTGCCGTTCCAGCTCACCGATGCTTTCGACGCCACGCTGACC
AACGAGCAGGCGGCCATCGGCTACATGGTTGTCCTGGTGCCATTCATCGCCGGGGCCATCATCAAGCTGG
GGCAGGGCGGTTTCATGGGTGTTGCCGACCGGATGATGACCGGCTTTGCCTCTGCCGGGGCGGCGGTGGG
CGCAAGCAATGCCAGCGGCAATGTCAGCATGGGCCAAGCTGGACTTGATACCGCATCGGTCAACACGACC
TCGATGAACAAGTACGACAGCAACATCGGCCTGCAAGGCGGCGGGGCAACCATCGGTCGGGGCAATGGCT
CGACTGCCACGATGGCCGCGAACGGCGCGGTTGCCTTGCAGCAGCTCCAAAACCGGATGCTGACGCAGAT
GAACATGGATCACCGACTGGAAGCCGGCCGCAACCAGGAAGCGCATCGTACCGACATCACATCGACCGGG
GATCAACTGGCGCGCCGGCACGGCGACAGCTCCAGCCTCACGGACGTGAAGGGGCACGATACAACCCGTG
GTCAATATCAGAATACGGGTGTGGTGGCGGCTCGCGGGAGCGAGGGTGGGTATGGTGGCCAGCACTCAAC
CGGCCAGAACTTGGATCGCAACTTCCGTGAGGGTTCGCACTTCCGCACGGCGGCCGGTGCCAATGACCAG
CTCCACATGAATTTGGGTGTTGGCCGTGGGAACCCCAGCGGCGGCGGTGCTCCTGGTGCGGGTGGCGCGG
GTGGCGCACCTGATCCGCGCGAGGAAAAGCGTATTGCCGACGCCATGAAGCAGGGCGGCGCGAACCAGCA
ACAGATCGACCAGGCGCTGAAGAACTACCGTGGCGGCAAGGGCGGTGCCCAGCCCTCGGGCAGTCTCATC
AATGCGGGCCTGGGGTACAACGGCGCGAAGACCTACACCGCCGAGCACGGCCGGGATCGTGGTGTGGACA
CGGTTCATGGGAACCAAGAGGCCGCACGCACCGAGCGCACGTTTGCTGAACGCGGCTCCCGCACCGAGCA
GGCCGGGACGGGCAATCAATCGGCCCAAAACGACCGCCACGGCCGCGATGCCGCCCTCACGAATGTGGAT
GAAGTTTCCCGCGTGCGTGATGTCTCTGATCGTCGTGAGTTCGGTACTGGCGACCGGGCCAACCGTAGTG
ATAGCAACAGCTTCACGACTCACAAGGATCTGATGGCCGATCCGTACCTGTTCGAGAAGGTGGCTGCGCG
CAATGGCATGACCGCCATGCGTTTCGCCAACCAATCCGAAGACCGGATCATGGAAATGGTGCAGGACTAT
GTGAGTGAGAAGGGCATGGTTCAGCAGGCCACCACCATGCCGCAGCAGACTTTCGCAGGCGAAAAACTGC
CGACCACGAAGGGTGAGCTGGAGAAGCAATCCGCCAAGGATCGCGCCGGCATCCCGCAGGACATCCAGGG
CGTCCACAAGAAGAAGGTGGCACAGACCGGCTACGGCGGAACCGCTCCGCTCAAGGTCGATACCTCTGCG
CCTCCGATCATTGCGGAATCCAGAGGCGACGTACAAGGCCAGCTCGATCCGAAGAACAAGGGCAGCATCC
CGGCGCGTGCTGGAGCCTTGGACGAGAACGTGAATGCCTGGGCCAGCCCGGACAAGGCCGTGGGCGCTGG
ACGGGCCAATCCCGCAGCCGTCAACGAGGACAACATGATCCGCGACGGCAAGGACACCGTTCAGAAGGCT
TGGGACAAGCTGACTGGCGGCGACGGTACGGCAGACGGCGAGAAGCTGAACGACAACATGAAGCGGGAAA
CGGCCGCCTCAGTTCAGATCAACAACGGTAGCAAGTAA
 Primer design