SecReT4
Protein ID: 121582472
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4168
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]5186..6592 [-]
ProductTraH family protein
Component typeTraH_F
UniProt IDA1WDE4
KEGG IDajs:Ajs_4168
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.8e-112, Aligned region: 24..383
Protein Sequence: 468 a.a.     [Download]
>gi|121582472|ref|YP_974004.1| TraH family protein [Acidovorax sp. JS42]
MLLKKVTALVTAFAFTTSTYAMNMQELFDSVNAQGNVSNPAVLQGQTMNLYTGGSLFMRMPKRTYQLATV
TPPSWNAGCGGIDLFAGGFSFINKEQFVAMLRNIGSNALGYGFKLAIQNLCPTCDNVMQALQATAQAANR
LNMDSCEAAKGIVNAAVPDTWTRGKQNAAKNFGVDTNIFENITDAWTNVMNSESRANQTVNSAASARPEA
KDQLPTGNVVWKALKKLDGVTDEQRMILMSMIGSMIFPTGDTPQLPIPLLRKEITVEALVGARTTSDTIT
VPIWRCDTTSADGCLSPTEDEVTTKSFKTMVREKMEKISDKIANRSAHDDMAATIGFLNATDLPIYKMLA
VTTTLNNTSMADALIGRYQELIAAKYAEVYIQRAVTDLRGAMAKFSAAADATQAAELGKMKPELEEISRA
AKQVLATAYSQTISTYNIAQEVQYMERALNANLSQTLRNSLAFGKSLR
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c6592-5186 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGCTACTGAAAAAAGTAACGGCGCTGGTGACGGCATTTGCTTTCACCACCTCTACCTACGCCATGAACA
TGCAGGAGCTTTTCGACTCCGTGAATGCTCAAGGCAACGTCAGCAACCCGGCCGTGCTGCAAGGCCAGAC
GATGAACCTCTACACCGGGGGCAGTCTGTTCATGCGGATGCCCAAGCGCACCTACCAACTGGCGACGGTG
ACGCCGCCGAGCTGGAACGCTGGGTGCGGCGGCATTGACCTGTTCGCGGGCGGCTTCTCGTTCATCAACA
AAGAGCAGTTCGTGGCCATGCTGCGCAACATTGGCTCGAATGCCCTGGGCTACGGCTTCAAGCTGGCCAT
TCAGAACCTGTGCCCGACCTGCGACAACGTGATGCAGGCCCTGCAAGCCACGGCGCAAGCTGCCAATCGT
CTCAACATGGATTCCTGCGAGGCGGCCAAGGGGATCGTCAATGCGGCCGTGCCCGACACCTGGACGCGCG
GCAAGCAAAACGCGGCCAAGAACTTTGGTGTGGACACCAACATTTTCGAGAACATCACCGACGCTTGGAC
GAACGTGATGAACAGCGAAAGCCGGGCCAACCAGACGGTGAACTCGGCGGCCAGCGCGCGACCCGAGGCG
AAAGACCAGCTCCCGACCGGCAACGTGGTTTGGAAGGCGCTCAAGAAGCTCGATGGCGTCACCGACGAGC
AACGCATGATCCTGATGTCGATGATCGGCAGCATGATTTTCCCGACCGGCGACACCCCGCAACTGCCTAT
CCCGCTGCTGCGCAAGGAAATCACGGTGGAGGCCCTGGTGGGTGCGCGTACCACCTCCGACACCATCACG
GTGCCGATCTGGCGTTGCGACACCACCAGCGCGGACGGCTGCTTGAGTCCGACCGAGGATGAAGTGACCA
CCAAGAGCTTCAAGACGATGGTGCGGGAGAAGATGGAAAAAATCTCCGACAAGATCGCCAACCGTTCAGC
TCACGACGACATGGCGGCCACCATCGGCTTCCTGAACGCAACCGATCTGCCCATCTACAAGATGCTGGCC
GTGACGACAACCCTCAACAACACCTCGATGGCCGACGCGCTGATTGGCCGCTACCAGGAGCTGATCGCCG
CCAAATACGCCGAGGTTTACATCCAGCGTGCCGTCACCGACCTGCGCGGCGCGATGGCGAAGTTCTCTGC
CGCAGCCGATGCCACCCAGGCCGCCGAGCTGGGCAAGATGAAGCCCGAGCTGGAGGAAATTTCGCGCGCG
GCAAAGCAGGTGCTGGCCACTGCCTACTCGCAGACCATCAGCACCTACAACATCGCCCAGGAGGTGCAGT
ACATGGAGCGTGCGCTGAATGCCAACCTGTCGCAGACGCTGCGTAACTCGCTCGCCTTCGGCAAGAGCCT
GCGCTAA
 Primer design