SecReT4
Protein ID: 121582473
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4169
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]6603..7415 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDA1WDE5
KEGG IDajs:Ajs_4169
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 9.6e-72, Aligned region: 35..259
Thioredoxin_2 [PF13098], Evalue: 7.7e-06, Aligned region: 165..237
Protein Sequence: 270 a.a.     [Download]
>gi|121582473|ref|YP_974005.1| hypothetical protein Ajs_4169 [Acidovorax sp. JS42]
MMKRSLLLLALLSGYANAQSLDYPSVWQCDANKPNWYCDMEDAKPQPVQPTPAPARQQTSRKADQPKRIE
LKDIKTAEQLRQELKRREDVAVMNPTDQNMKDYLELWQMTQDKGAVFADNWRRVVWQNPSLDYAQKRPVN
NSAIKIYDEGRIQNEEQQLKMLAKEHGLIFFFRSDCPYCHAMAPTLKMLSDKYGIEVLPVSVDGMGLPEF
PNPRDGRAQAAAWGIERVPALFIGSKQTGDRAPVGFGMMALTEIVNRIFVLTGTKPGDNF
 
Nucleotide Sequence: 813 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c7415-6603 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGATGAAGCGAAGCCTTCTCCTGCTGGCCCTGCTGTCCGGGTACGCCAATGCGCAGTCACTGGATTACC
CGTCTGTTTGGCAGTGCGATGCGAACAAGCCCAACTGGTACTGCGACATGGAAGACGCCAAGCCGCAACC
TGTGCAGCCGACGCCGGCACCGGCACGGCAGCAGACTAGCCGCAAGGCTGACCAGCCAAAGCGCATCGAG
CTGAAGGACATCAAGACCGCCGAGCAACTGCGACAAGAACTGAAGCGCCGGGAAGACGTGGCGGTGATGA
ACCCCACCGACCAGAACATGAAGGACTACCTGGAGCTTTGGCAGATGACGCAGGACAAGGGGGCTGTCTT
CGCTGACAACTGGCGGCGCGTGGTCTGGCAAAACCCGAGCCTCGACTACGCGCAAAAGCGGCCGGTCAAT
AACTCCGCGATCAAGATTTACGACGAAGGCCGCATTCAGAACGAGGAACAGCAACTGAAGATGTTGGCCA
AGGAGCACGGGCTGATCTTCTTCTTCCGTAGCGACTGCCCGTACTGCCATGCAATGGCCCCGACGCTGAA
GATGCTTTCCGACAAGTACGGCATCGAGGTGCTGCCGGTATCAGTCGATGGCATGGGCCTGCCCGAGTTC
CCGAACCCCCGCGACGGCCGCGCGCAAGCTGCGGCTTGGGGGATTGAGCGCGTGCCGGCACTGTTCATTG
GCTCAAAGCAGACCGGCGACCGTGCGCCCGTGGGCTTCGGAATGATGGCCCTAACCGAAATCGTCAATCG
AATCTTTGTCCTCACCGGCACCAAGCCCGGCGATAACTTCTAA
 Primer design