SecReT4
Protein ID: 121582475
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4171
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]7779..9023 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA1WDE7
KEGG IDajs:Ajs_4171
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.2e-48, Aligned region: 23..191
TraN [PF06986], Evalue: 1.2e-48, Aligned region: 292..360
Protein Sequence: 414 a.a.     [Download]
>gi|121582475|ref|YP_974007.1| conjugal transfer mating pair stabilization protein TraN [Acidovorax sp. JS42]
MMMKKILAALAFVASFSAFAAPDCQKTGTVCTAPNQTRNVSGLSVFRECWEYQDTYQCRSQNMVNDCQPL
RDKGCSQIGSSCVERDDSGTCVMYEQKYNCPDKPETYTEKTVCDQSAFCQNGGAGCFDTSAPPDKDFGQA
AVMMEAAREAGVYGIDPNKVEIFKGYMEECSIKVLGGTTLKSCCKSAGGGAAFSNYALLGAGMKAAGEAG
RESIVLGSKYMYDSLYGQLDSSLVDKGLGAMNSWASGLGDGVFNPQFGFYGFTFEFTFANGFQFVGFDPY
SFALSVAIMLVQEWLSCDSAEQVMAMKRGQNLCVHIETYCSKKVLKVCVEKKERHCCFNSKLAKIINRQG
RAQLGMPMNSCGGFNQAQLQALDFSRIDLSEFIADIVPKDVPASTMSNRVQQTVNKKVQSYYDQ
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c9023-7779 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGATGATGAAGAAGATTCTTGCCGCATTGGCCTTTGTCGCCAGCTTCAGCGCCTTCGCAGCGCCTGACT
GCCAGAAGACGGGAACGGTTTGCACCGCGCCCAACCAGACCCGCAACGTGTCGGGCCTGTCCGTCTTCCG
TGAATGCTGGGAATACCAGGACACCTATCAATGCCGCAGCCAGAACATGGTCAACGACTGCCAGCCGCTG
CGAGACAAGGGGTGCTCACAGATCGGATCGTCATGCGTGGAGCGCGACGATTCCGGCACCTGCGTGATGT
ACGAGCAGAAATACAACTGCCCGGACAAGCCTGAAACCTACACCGAGAAAACGGTGTGCGATCAAAGCGC
CTTCTGCCAGAACGGCGGGGCTGGGTGCTTTGATACCAGCGCGCCACCCGACAAGGACTTTGGCCAAGCG
GCCGTGATGATGGAGGCCGCCCGCGAGGCCGGCGTGTACGGCATCGACCCGAACAAGGTCGAAATCTTCA
AGGGCTACATGGAGGAATGCAGCATCAAGGTCTTGGGTGGCACCACGCTCAAGAGCTGCTGCAAGTCAGC
CGGTGGTGGCGCTGCCTTCAGCAATTACGCGCTCCTGGGCGCAGGCATGAAGGCGGCAGGCGAAGCGGGC
CGCGAATCCATCGTGCTGGGTTCCAAGTACATGTACGACTCGCTGTATGGCCAGCTCGACAGCTCCCTTG
TAGATAAGGGACTTGGCGCAATGAATAGCTGGGCCTCCGGCTTGGGTGATGGTGTCTTCAATCCGCAATT
CGGGTTCTATGGCTTCACTTTTGAGTTCACCTTTGCCAACGGCTTCCAGTTCGTCGGTTTTGACCCGTAC
AGCTTCGCCCTGTCCGTGGCAATCATGCTGGTGCAGGAATGGTTGAGCTGCGATTCGGCCGAGCAGGTCA
TGGCCATGAAGCGCGGCCAAAACCTGTGCGTCCATATTGAGACGTATTGCAGCAAGAAGGTGCTCAAGGT
CTGCGTGGAGAAGAAGGAACGCCACTGCTGCTTTAACTCCAAGCTGGCCAAGATCATCAACCGCCAAGGC
CGCGCCCAACTCGGGATGCCGATGAATAGCTGCGGCGGCTTCAACCAGGCGCAGCTCCAGGCCCTCGATT
TCTCCCGGATTGATCTGTCCGAGTTCATCGCGGACATCGTGCCCAAGGATGTGCCGGCATCGACCATGAG
CAACCGGGTGCAGCAGACCGTCAACAAAAAAGTTCAGAGCTACTACGACCAATGA
 Primer design