SecReT4
Protein ID: 121582477
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4173
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]10315..11091 [-]
Producthypothetical protein
Component typeTrbC_F
UniProt IDA1WDE9
KEGG IDajs:Ajs_4173
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.3e-32, Aligned region: 127..236
Protein Sequence: 258 a.a.     [Download]
>gi|121582477|ref|YP_974009.1| hypothetical protein Ajs_4173 [Acidovorax sp. JS42]
MNKKTVIGLMLLAAFARESVAQSTPTASQLDQERQRIELERKQMFDPNNPASKAKKGAMPNSADIDREMR
RVDRERKQMFDPNNPATKNAANVFPNVPTPERAGIDIEALAKQYEQKAQARKMDDLMIFASFTMPAESLK
RIVSQANRVGASVVLRGFKNNSLKDTALAIKELGEQGGNVLVNPNAFTKYKVKAVPTMVLAKAATIDQVD
NEGCALPDNFVAVAGDVSLDYALDEIVRRAPQFEAVASRYLRQIRGNQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c11091-10315 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGAACAAGAAAACTGTCATCGGGCTGATGCTGCTGGCCGCTTTCGCCCGCGAAAGCGTGGCGCAGAGCA
CGCCGACCGCATCCCAGCTCGACCAAGAACGCCAACGCATCGAGCTTGAGCGCAAGCAGATGTTTGACCC
GAACAACCCCGCCTCGAAGGCCAAGAAGGGCGCTATGCCCAACTCGGCCGACATCGACCGGGAAATGCGC
CGCGTAGATCGTGAACGCAAGCAGATGTTCGATCCAAACAACCCCGCGACCAAGAACGCCGCCAACGTGT
TCCCCAACGTGCCGACGCCGGAGCGCGCCGGGATCGACATCGAGGCGCTGGCCAAGCAATACGAGCAAAA
GGCCCAGGCCCGCAAGATGGATGACCTGATGATTTTCGCCAGCTTCACGATGCCGGCCGAATCACTCAAG
CGGATCGTCAGCCAAGCCAACCGGGTGGGGGCTTCTGTGGTGCTGCGCGGTTTCAAGAACAACTCGCTGA
AGGATACGGCGCTGGCCATCAAGGAGCTGGGAGAGCAGGGCGGCAACGTCCTGGTGAACCCCAACGCCTT
CACCAAGTACAAGGTCAAGGCTGTTCCCACGATGGTGCTGGCCAAGGCCGCAACCATCGACCAAGTGGAC
AACGAGGGCTGCGCCCTCCCTGACAACTTTGTGGCAGTGGCCGGTGACGTTTCGCTGGACTACGCCCTGG
ACGAGATTGTGCGCCGCGCTCCGCAGTTTGAAGCCGTGGCGTCTCGCTACCTTCGCCAGATCAGGGGGAA
CCAATGA
 Primer design