SecReT4
Protein ID: 121582478
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4174
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]11091..12092 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDA1WDF0
KEGG IDajs:Ajs_4174
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5.3e-84, Aligned region: 27..328
Protein Sequence: 333 a.a.     [Download]
>gi|121582478|ref|YP_974010.1| TraU family protein [Acidovorax sp. JS42]
MKRWLVMAFMVLAATFARESMAGVCQGKFANPITDICWSCLFPLTLGGTPIMTMGQEDTGNPDGFLCTCT
NPLRIGIKTGFWEPARRVDVTRTPYCFVSLGGIKLDPGIRAPEGEIRLQQDNTKQSNYQVHWYADPILYW
LEVILDNPCLETGSFDVAYITEVDPTWNDDELTMLLNPETFLFGNPIAQAACAGDCVLSSAGFGSNALFW
CAGCQGSIYPFNGHVQAHVSHVQASSLLVQRMTAKLHREFLMWGTSGADGLCGIYPEPVMDKTQYKYQML
YPIPQTEKINGRCCQPYGRTTAIWGAGKSYPYAGEDFAYMIFRKKNCCLGVGF
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c12092-11091 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGAAACGCTGGCTTGTAATGGCTTTCATGGTGCTCGCGGCGACTTTCGCGCGCGAAAGTATGGCCGGCG
TGTGCCAGGGCAAGTTTGCCAACCCCATCACCGATATTTGCTGGAGCTGCCTGTTCCCGCTGACGTTGGG
CGGCACGCCGATCATGACGATGGGCCAGGAGGACACCGGCAACCCGGACGGCTTCCTCTGCACCTGCACC
AACCCGCTGCGCATCGGCATCAAGACCGGCTTTTGGGAGCCGGCGCGGCGCGTGGATGTGACCCGCACCC
CGTACTGCTTTGTCTCGCTGGGAGGCATCAAGCTCGATCCCGGTATCCGTGCCCCGGAAGGCGAGATCCG
TTTGCAGCAGGACAACACCAAGCAGTCCAACTATCAGGTTCATTGGTACGCCGATCCGATCCTTTATTGG
CTGGAGGTGATCCTGGATAACCCGTGCCTGGAGACGGGTTCCTTTGACGTGGCCTACATCACCGAAGTCG
ATCCGACTTGGAACGACGACGAGCTGACCATGCTGCTGAACCCGGAAACTTTCCTGTTCGGAAACCCCAT
TGCCCAAGCCGCGTGTGCCGGCGACTGCGTGTTGTCATCGGCTGGCTTTGGCAGTAACGCGCTTTTCTGG
TGCGCCGGCTGCCAGGGTTCGATCTACCCCTTCAACGGCCATGTGCAGGCCCACGTCTCACACGTACAAG
CCAGTTCGCTGCTGGTGCAGCGCATGACGGCCAAGCTGCACCGCGAATTCCTGATGTGGGGCACCTCTGG
CGCTGACGGCTTGTGCGGCATCTATCCCGAGCCGGTGATGGACAAGACCCAATACAAGTACCAGATGCTC
TACCCGATCCCGCAGACGGAAAAGATCAACGGACGCTGCTGCCAACCCTATGGCCGCACGACCGCGATTT
GGGGCGCTGGCAAGAGCTACCCGTATGCCGGCGAAGACTTCGCCTACATGATTTTCCGCAAGAAAAACTG
CTGCCTGGGAGTGGGATTCTGA
 Primer design