SecReT4
Protein ID: 121582479
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4175
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]12089..12727 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDA1WDF1
KEGG IDajs:Ajs_4175
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7e-09, Aligned region: 6..34
Protein Sequence: 212 a.a.     [Download]
>gi|121582479|ref|YP_974011.1| hypothetical protein Ajs_4175 [Acidovorax sp. JS42]
MRFSKLIAALLIASILPAANAASLGSIGPTYPIGEESALDMIMKKLREKERSGELKRLQEEAIRRSMGSI
KNMKPVDGITTVRARAQRFIDPTVTYTKPVTTDDGRIVVPAGTKINPLDMTSLTKTLVFFDGRDPEQREA
VGRLVAKGGQLKVKPILVAGSWLDLTKAWKTQVFYDQKGTLSKRFGITAVPAVIRQQGKMLVLDEIPAKE
LQ
 
Nucleotide Sequence: 639 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c12727-12089 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGAGATTTTCTAAGCTGATCGCAGCCCTGCTGATCGCCTCGATCCTGCCTGCCGCGAACGCGGCGAGCT
TGGGCAGCATTGGGCCGACCTACCCGATTGGGGAGGAAAGCGCCCTCGACATGATTATGAAGAAGCTGCG
CGAAAAGGAGCGTAGCGGCGAGCTGAAGCGGTTGCAGGAAGAAGCCATCCGCCGCTCGATGGGCAGCATC
AAGAACATGAAGCCGGTGGACGGTATCACCACCGTGCGCGCCCGCGCGCAGCGTTTCATCGACCCCACCG
TGACCTACACCAAGCCGGTGACGACCGACGACGGCCGCATCGTGGTGCCGGCTGGAACGAAGATCAACCC
GCTGGACATGACCAGCCTGACGAAGACGCTGGTTTTCTTCGACGGCCGCGACCCCGAACAGCGCGAAGCA
GTGGGGCGCTTGGTGGCCAAGGGCGGCCAGCTCAAGGTGAAGCCGATTCTCGTTGCTGGGTCTTGGCTCG
ACCTCACCAAAGCCTGGAAGACCCAAGTTTTCTACGACCAGAAGGGCACCCTTTCCAAACGGTTCGGCAT
CACGGCCGTGCCGGCTGTGATTCGTCAGCAGGGAAAGATGCTTGTGCTCGATGAGATTCCCGCGAAGGAG
CTGCAATGA
 Primer design