SecReT4
Protein ID: 121582482
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4178
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]13608..16232 [-]
Producthypothetical protein
Component typeTraC_F
UniProt IDA1WDF4
KEGG IDajs:Ajs_4178
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.3e-57, Aligned region: 45..289
AAA_10 [PF12846], Evalue: 5.9e-55, Aligned region: 488..776
Protein Sequence: 874 a.a.     [Download]
>gi|121582482|ref|YP_974014.1| hypothetical protein Ajs_4178 [Acidovorax sp. JS42]
MQDSMMDKLKGAAARFWDETVLGNTSDVGSQPAPVAAANEVTSLYGLHSILKYDQYDPDTGLFYNDNSVA
FCFEVIAQTGADDDMASRLNTLFTLVPPHYGIQWCLFGSPVLDDQFQAYMDQRHIAVDNGKTTPFFQELA
KRRVEYIYKAKGKPLWPNDNYVVKNIRLLFSITKAGSFRDAKLVEEMYELRETVRASLRTASLPSFPLDA
DGLISFLWPILNPESMFSKEPFPDLRYDDGKSIKNQVTAFGQHVRVKANELLFGLPPEKQGDEDKRIAVR
GFGVLQYPQKKELWEMANIIGSFFDDGLQYPCPFLVCGGVFTLDPNVVDGKAQIKAARTKQNAKSKMAEF
QPELQAQANDWDIVLHQLNNGGSMCELYHTLLLFAPKRVINRASQVALNVWRSERFTICPLQLLQLTALY
SSLPMTLTETVRDDLQKLRLITSKTTVNAVDMAPVIGEWKGAGDPVMMFFGRRGTPTFLDFYSNQQGNYN
VFVAGVSGSGKSVTMNEVVSAYRGIGARVWVIDVGRSYQNLIRLQKGTFLEFTPSTKLCINPFTWVGTDD
ELDFKAEMRMLKPMIGRMASPNAPLTEFQYALIGEAITAVWQDYGQDTNPTRIRDYLLSNIKNESGSTER
VAYELAKQLAPFTKDGVYGDFFNGRANISLDADMVGLELEELKNAPELRRVVLFVLTSRIAHDMYLTRDR
KKLCLVDEAWQLLGADKETAEFIEEGYRRARKYNGIFCVGTQGIEDAYKNDAAQAAYNNADWKILLRQDR
KNLEKLIEDGMVNFSPAVKRMLLSLRTERGRFSEMLISSPNGDSVVRHIPDPFSLLMASTNAQDFNECNA
LLEQGHSTMEALEIMLARRAPQEQLSPRRRKDDY
 
Nucleotide Sequence: 2625 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c16232-13608 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGCAAGACAGCATGATGGACAAGCTAAAGGGTGCTGCCGCCCGGTTTTGGGACGAAACCGTGCTGGGCA
ACACCTCGGATGTCGGGAGCCAGCCGGCCCCCGTGGCGGCCGCCAACGAGGTGACGAGCCTCTACGGGCT
GCACAGCATCCTCAAGTACGACCAATACGACCCCGACACGGGCCTTTTCTACAACGACAACTCGGTGGCC
TTCTGCTTTGAAGTCATCGCGCAAACCGGCGCGGACGACGACATGGCGAGCCGCCTCAATACGCTCTTTA
CCCTGGTGCCGCCGCACTACGGGATTCAGTGGTGCCTGTTCGGTAGCCCGGTGCTGGATGACCAGTTCCA
AGCGTACATGGATCAACGCCATATCGCGGTGGACAACGGCAAGACCACGCCGTTCTTCCAGGAGCTGGCA
AAGCGCCGCGTGGAGTACATCTACAAGGCAAAGGGCAAACCGCTTTGGCCCAATGACAACTACGTGGTGA
AGAACATCCGCCTGCTGTTCTCCATCACCAAAGCCGGTTCCTTCCGTGACGCCAAGCTGGTGGAGGAAAT
GTACGAGCTGCGCGAGACAGTGCGCGCTTCGCTGCGCACGGCAAGCCTGCCGTCCTTTCCCCTCGATGCT
GACGGCCTGATTAGCTTCCTGTGGCCGATCCTCAACCCCGAAAGCATGTTCAGCAAGGAGCCGTTCCCCG
ATCTGCGCTACGACGACGGGAAATCCATCAAAAATCAAGTCACGGCCTTTGGCCAGCATGTGCGCGTGAA
AGCCAACGAGCTGCTGTTTGGCCTGCCGCCCGAGAAGCAGGGCGACGAAGACAAGCGCATCGCCGTGCGT
GGCTTCGGCGTGCTTCAGTACCCGCAGAAGAAAGAGCTGTGGGAGATGGCCAACATCATCGGTTCGTTTT
TCGATGACGGCCTTCAATACCCGTGCCCATTCCTGGTGTGCGGTGGCGTCTTCACGCTTGACCCCAACGT
GGTGGACGGCAAGGCTCAGATCAAGGCCGCACGCACCAAGCAAAACGCCAAGTCCAAGATGGCCGAGTTC
CAGCCCGAGCTTCAGGCCCAGGCGAACGATTGGGACATCGTGCTGCACCAGCTCAACAACGGCGGCAGCA
TGTGCGAGCTGTACCACACGCTGCTGCTGTTCGCACCCAAGCGCGTCATCAACCGGGCAAGCCAAGTGGC
CCTGAACGTGTGGCGCAGCGAACGCTTCACGATCTGCCCGCTGCAACTGCTGCAACTGACGGCCCTGTAT
TCCAGCCTGCCCATGACGCTCACCGAGACGGTGCGCGACGACTTGCAGAAGCTACGCCTCATCACGTCCA
AGACCACGGTGAACGCGGTGGACATGGCCCCGGTGATTGGCGAATGGAAGGGCGCAGGCGACCCGGTGAT
GATGTTCTTTGGCCGTCGTGGCACCCCTACCTTCCTCGACTTCTACAGCAACCAGCAGGGCAACTACAAC
GTGTTCGTGGCGGGCGTGTCCGGTTCGGGCAAGTCCGTGACCATGAACGAAGTCGTTTCGGCCTATCGAG
GTATTGGCGCGCGGGTGTGGGTGATCGACGTGGGCCGCAGCTATCAGAACCTGATCCGGCTCCAGAAAGG
CACCTTCCTGGAGTTCACGCCGAGCACGAAGCTGTGCATCAATCCATTCACTTGGGTGGGCACCGACGAC
GAGCTGGATTTCAAGGCGGAAATGCGGATGCTCAAGCCGATGATCGGCCGCATGGCGTCCCCCAATGCGC
CGCTGACGGAATTCCAGTACGCGCTGATCGGGGAGGCGATTACCGCCGTCTGGCAAGACTACGGGCAGGA
CACCAACCCGACCCGCATCCGCGACTACCTGTTGAGCAACATCAAGAACGAGTCGGGCAGCACCGAGCGC
GTGGCCTACGAGCTGGCCAAGCAGCTCGCGCCGTTCACCAAGGATGGCGTCTATGGGGACTTCTTCAACG
GCCGCGCCAACATCAGCTTGGACGCCGACATGGTGGGGCTGGAGCTGGAGGAACTGAAGAACGCTCCCGA
GCTGCGCCGCGTGGTGCTGTTCGTGCTGACCTCGCGCATTGCCCACGACATGTATCTGACCCGCGACCGC
AAGAAGCTGTGTCTGGTCGATGAGGCATGGCAGCTCCTGGGGGCTGACAAGGAAACCGCAGAGTTCATCG
AGGAAGGCTACCGCCGCGCCCGGAAGTACAACGGCATTTTTTGTGTGGGCACGCAAGGTATCGAAGACGC
CTATAAAAATGATGCGGCCCAGGCGGCCTACAACAACGCCGACTGGAAGATTCTGCTGCGCCAAGACCGC
AAGAACCTGGAAAAGCTGATCGAGGACGGCATGGTGAATTTCTCGCCGGCCGTGAAGCGGATGCTGCTGT
CGCTGCGCACCGAGCGCGGCCGCTTCAGCGAAATGCTCATTTCCTCGCCCAACGGCGATTCCGTGGTGCG
CCACATCCCCGATCCCTTCTCCCTGCTGATGGCTTCGACCAACGCGCAGGACTTCAACGAATGCAACGCG
CTGCTGGAGCAGGGCCATTCCACGATGGAAGCCCTGGAAATCATGCTGGCCCGCCGCGCCCCTCAAGAAC
AACTGTCCCCGCGCCGGAGGAAAGATGACTACTGA
 Primer design