SecReT4
Protein ID: 121582483
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4179
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]16270..16920 [-]
Productmembrane lipoprotein lipid attachment site
Component typeTraV_F
UniProt IDA1WDF5
KEGG IDajs:Ajs_4179
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.1e-24, Aligned region: 28..127
Protein Sequence: 216 a.a.     [Download]
>gi|121582483|ref|YP_974015.1| membrane lipoprotein lipid attachment site [Acidovorax sp. JS42]
MKALALTFGIGAVVALSGCSSMSGFDAKSEFACKAPDGILCESMSGIYANAQAKNLPGQRVNARGEAPVE
LSQAKAGSNVMTKPIYSGTPIRSAPRLLRVWFAPWEDTDGDLHDQSYVYLPVDSGRWLIEHNRRRIQDNY
RPVRAPSNVTAQAAQPQTAGAGQQRQSPGVLGQQPTPPADNGMESIGIRQDRMSNEQATELLNGIMRPGN
VIPDSE
 
Nucleotide Sequence: 651 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c16920-16270 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGAAGGCACTGGCCTTGACCTTTGGCATCGGGGCCGTGGTGGCCCTATCCGGTTGCAGCAGCATGTCTG
GCTTTGATGCGAAATCCGAATTCGCGTGCAAGGCCCCGGACGGCATCTTGTGCGAGTCGATGAGCGGCAT
CTACGCCAATGCCCAGGCGAAGAACCTGCCGGGCCAGCGCGTGAATGCGCGCGGCGAGGCTCCGGTGGAA
CTTTCGCAGGCGAAAGCCGGCAGCAACGTGATGACCAAGCCCATCTACTCGGGCACGCCGATCCGCAGCG
CACCGCGCCTGCTTCGCGTCTGGTTCGCCCCGTGGGAAGACACCGATGGCGATCTGCACGACCAGTCCTA
CGTGTACCTGCCGGTCGATTCCGGCCGCTGGCTGATCGAGCACAACCGCCGCCGCATCCAGGACAACTAC
CGGCCGGTACGCGCCCCGTCGAATGTGACGGCCCAGGCTGCGCAGCCGCAAACGGCCGGCGCTGGCCAGC
AACGGCAAAGCCCTGGCGTGCTGGGGCAGCAGCCAACGCCTCCCGCTGACAACGGGATGGAGTCTATCGG
CATCCGTCAAGACCGCATGAGCAACGAGCAAGCCACCGAGCTGCTGAACGGAATCATGCGCCCCGGCAAC
GTCATCCCGGACAGCGAATAA
 Primer design