SecReT4
Protein ID: 121582485
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4181
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]17805..19154 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDA1WDF7
KEGG IDajs:Ajs_4181
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.5e-40, Aligned region: 223..420
Protein Sequence: 449 a.a.     [Download]
>gi|121582485|ref|YP_974017.1| TraB pilus assembly family protein [Acidovorax sp. JS42]
MSEPNAQTKKRQMMLIGGAVTGILGLAGAGMFLFDSGPAQHREKPKTVSITAPGTVDDKDAWRAQQAAKE
KSNEALIGEVKTQLKAQEEQNKKLAQALEELKANKAAAGSAGSATAAKPDASVLDKPLPIGNGTGPGQRV
LQSPNGKGGATTLNQPLNQVDVPARREVEIITFNNAEGKGAAGAAVGGAGGITEVLGFPTDEKAKKYGTT
SGGADGKKQTIEFLPAGSFVRVAMLNGVDAPTGGQAQSNPLPVAFHVLDVANLANKHKLDIKDCRIVAAT
WGDLSSERMMGRTETLACVINGEAVEMAIKGQVIGEDGKAGVRGRLVTKQGQLLANALFAGALSGIGKAF
QSSATITSTGGGGITQTIDPDKIGQAAIGGGVGSAGQQLAQYYLKAADKLYPVIETDGGRTVEILITKGA
VYSGKALAKDDYRGLLKRTGTNSRRYEDD
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c19154-17805 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGAGTGAGCCGAACGCACAAACAAAGAAACGCCAGATGATGCTCATCGGCGGGGCAGTGACCGGCATTC
TCGGTCTGGCCGGGGCTGGCATGTTCCTGTTCGACAGTGGCCCAGCACAGCACCGCGAAAAGCCCAAGAC
CGTCAGCATCACCGCACCGGGCACCGTAGATGACAAGGATGCGTGGCGTGCGCAGCAAGCGGCCAAGGAG
AAGTCCAACGAAGCCTTGATCGGGGAAGTTAAGACCCAGCTCAAGGCCCAGGAGGAACAGAACAAGAAGC
TCGCGCAGGCGCTGGAGGAACTGAAGGCCAACAAGGCCGCAGCCGGTTCGGCTGGCAGCGCAACGGCTGC
GAAGCCAGATGCTTCGGTTCTGGACAAGCCTTTGCCCATTGGCAACGGCACCGGGCCGGGCCAGCGTGTT
CTCCAGTCACCGAACGGCAAAGGCGGAGCCACCACCCTAAACCAGCCGCTCAATCAGGTGGATGTGCCGG
CGCGGCGGGAAGTGGAAATCATCACCTTCAACAATGCCGAGGGCAAGGGCGCAGCGGGCGCAGCCGTTGG
CGGCGCTGGTGGCATCACCGAGGTGCTGGGCTTCCCAACCGACGAGAAGGCCAAGAAGTACGGCACCACC
TCGGGCGGGGCAGACGGCAAGAAGCAGACCATCGAGTTTCTGCCGGCTGGCTCCTTTGTGCGCGTGGCCA
TGCTCAACGGCGTGGATGCGCCGACAGGCGGGCAAGCCCAATCGAACCCGCTGCCGGTGGCTTTCCATGT
GCTCGATGTCGCCAATCTGGCCAACAAGCACAAGCTGGACATCAAGGATTGCCGCATCGTGGCCGCCACC
TGGGGCGATCTGTCCTCAGAGCGGATGATGGGCCGCACCGAAACCTTGGCCTGCGTTATCAACGGCGAGG
CCGTTGAAATGGCGATCAAGGGCCAAGTGATTGGGGAAGACGGCAAGGCTGGGGTTCGGGGCCGTCTCGT
CACCAAGCAGGGCCAGTTGCTCGCCAATGCCCTGTTTGCCGGCGCGCTCAGTGGTATCGGCAAAGCCTTC
CAGTCCTCCGCAACCATCACCAGCACAGGCGGCGGCGGCATCACGCAAACCATCGACCCGGACAAGATCG
GGCAAGCCGCTATCGGTGGTGGGGTAGGCAGCGCGGGCCAGCAGCTCGCTCAGTACTACCTCAAGGCTGC
GGACAAGCTGTACCCCGTCATCGAAACCGATGGCGGCCGTACCGTCGAAATCCTCATCACCAAGGGCGCT
GTTTATTCCGGCAAGGCGCTCGCCAAGGACGATTACCGGGGCCTCCTGAAGCGCACCGGCACCAACTCCA
GGAGATACGAAGATGATTAA
 Primer design