SecReT4
Protein ID: 121582486
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4182
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]19147..19884 [-]
Producthypothetical protein
Component typeTraK_F
UniProt IDA1WDF8
KEGG IDajs:Ajs_4182
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.6e-52, Aligned region: 9..237
Protein Sequence: 245 a.a.     [Download]
>gi|121582486|ref|YP_974018.1| hypothetical protein Ajs_4182 [Acidovorax sp. JS42]
MFPRSKKSLSAILLLTSLLATEAGATQVVENADRGHVQVNISVNETNRLAIDGRRIANVVPSVKGVLAGQ
KDEALGAYYFTLASESPNQGTVTVFVSDEKGVTYKLILVPRPVAGEEIIIRPPSEKATPSSRAAADGRTV
SYQRRIKDLMLVMADDELKDSVETIQVNKEVPLWKEGRLILVAKYMDGEVVGEKYRLTNVSPSEMLLVEQ
ELYRRGVRAIAVEHHTLMQGDGTDIYIVRERKDNE
 
Nucleotide Sequence: 738 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c19884-19147 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGTTTCCAAGATCGAAGAAATCGTTAAGCGCGATCCTTCTGCTAACAAGCCTGCTGGCAACTGAAGCAG
GCGCAACGCAAGTCGTTGAGAACGCTGACCGGGGCCACGTTCAAGTCAATATCTCGGTCAACGAAACCAA
CCGTCTCGCAATCGACGGGCGCCGCATTGCCAATGTGGTGCCCAGCGTGAAGGGCGTGCTGGCAGGCCAG
AAGGACGAGGCCCTGGGGGCTTACTACTTCACGCTGGCCAGCGAGTCGCCCAACCAGGGCACGGTCACGG
TTTTCGTGTCCGACGAGAAGGGCGTTACCTACAAGCTGATCCTCGTTCCGCGTCCGGTGGCCGGCGAGGA
AATCATCATCCGGCCGCCGAGCGAGAAGGCTACGCCTTCGAGCCGCGCAGCCGCTGATGGCCGCACCGTC
TCCTACCAGCGCCGCATCAAGGACTTGATGCTGGTGATGGCCGACGACGAGCTGAAGGACAGCGTTGAAA
CCATCCAGGTGAACAAGGAAGTGCCTTTGTGGAAAGAGGGGCGCTTGATCTTGGTGGCCAAGTACATGGA
TGGCGAAGTGGTGGGCGAGAAATACCGCCTGACCAACGTTTCCCCCTCCGAAATGCTGCTGGTCGAGCAG
GAGCTTTACCGCCGTGGCGTGCGCGCCATTGCCGTAGAGCACCACACGCTGATGCAGGGCGACGGGACGG
ACATCTACATCGTTCGGGAGCGCAAAGACAATGAGTGA
 Primer design