SecReT4
Protein ID: 121582487
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4183
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]19820..20413 [-]
Producthypothetical protein
Component typeTraE_F
UniProt IDA1WDF9
KEGG IDajs:Ajs_4183
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 9.6e-30, Aligned region: 11..186
Protein Sequence: 197 a.a.     [Download]
>gi|121582487|ref|YP_974019.1| hypothetical protein Ajs_4183 [Acidovorax sp. JS42]
MAPDKAINERDKLQSQVRFHRAMNAGLLGTLFFGVLLLGFVVVRDTTKIVPPEVKRPYEIGSNYANKDYL
LDMAGYVLGTVLTVTPETVDYNNKVILKMADPDGYAGLKTALDAAAMRLKQERVTTIWVPRKEEVSEQDK
RVKVSGKLKTFIADKLTSEREKDYLVEFTITTSGRLYVSKIEEIVKRDPSANKPAGN
 
Nucleotide Sequence: 594 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c20413-19820 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGGCACCAGATAAAGCAATCAATGAGCGGGACAAGTTGCAATCGCAAGTCCGCTTCCACCGCGCGATGA
ACGCGGGCCTGCTGGGCACTCTGTTTTTCGGGGTGCTGCTGCTGGGCTTCGTCGTCGTGCGCGACACAAC
CAAGATCGTGCCGCCTGAAGTTAAGCGGCCCTACGAGATTGGATCGAACTACGCCAATAAGGACTACCTG
CTGGATATGGCCGGTTATGTCCTGGGCACGGTGTTGACCGTCACGCCGGAGACGGTTGATTACAACAACA
AGGTGATTCTCAAGATGGCCGACCCGGACGGCTACGCCGGGTTGAAGACCGCGCTTGATGCGGCCGCAAT
GCGGCTCAAACAGGAGCGAGTCACCACTATTTGGGTTCCTCGCAAAGAGGAAGTCAGCGAGCAGGACAAG
CGCGTGAAGGTCAGCGGAAAACTCAAGACCTTTATTGCCGACAAGCTCACTTCCGAACGCGAGAAGGACT
ATCTCGTTGAATTCACCATCACTACCTCGGGGCGTCTCTATGTTTCCAAGATCGAAGAAATCGTTAAGCG
CGATCCTTCTGCTAACAAGCCTGCTGGCAACTGA
 Primer design