SecReT4
Protein ID: 121582488
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4184
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]20428..20721 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDA1WDG0
KEGG IDajs:Ajs_4184
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.7e-19, Aligned region: 10..95
Protein Sequence: 97 a.a.     [Download]
>gi|121582488|ref|YP_974020.1| hypothetical protein Ajs_4184 [Acidovorax sp. JS42]
MSEKTDLSHYIPRRLDDGAKFLFWEMDVAMIGLMGVLVGIGSGFPVIGLFLGIGAAFFYGKLKAGKHPGM
ATHLLYWFTGFPEPKELPGSHIRELNG
 
Nucleotide Sequence: 294 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c20721-20428 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGTCCGAAAAAACGGATCTCTCTCACTACATCCCGCGCCGATTGGACGACGGAGCCAAATTCCTCTTTT
GGGAAATGGACGTTGCCATGATCGGCCTCATGGGCGTGTTGGTTGGCATTGGCTCAGGCTTCCCGGTGAT
TGGGCTGTTCCTCGGTATTGGAGCGGCCTTTTTCTACGGGAAGCTGAAGGCTGGGAAGCATCCGGGCATG
GCCACCCACCTCCTGTACTGGTTCACCGGGTTTCCCGAGCCGAAAGAGCTGCCGGGTAGCCACATTCGAG
AACTCAATGGATAG
 Primer design