SecReT4
Protein ID: 121582491
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4187
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]21549..22049 [-]
Productlytic transglycosylase, catalytic
Component typeOrf169_F
UniProt IDA1WDG3
KEGG IDajs:Ajs_4187
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 166 a.a.     [Download]
>gi|121582491|ref|YP_974023.1| lytic transglycosylase, catalytic [Acidovorax sp. JS42]
MYFSARALIAAASLMLPLAASATCWDEAGRGYGIDPLLLKAIAWKESRGWTGAVGPKLKDGNRALGLMQI
NTIHLPNLARFGIRREHLFDACTSQKVGAWVLADCIQRFGATWKSVGCYYAGPASTNVSAQVEYVRDVQR
FYEGYRRQQAHQISTSPAQVASFQGD
 
Nucleotide Sequence: 501 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c22049-21549 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGTACTTCTCTGCACGCGCACTGATCGCGGCGGCATCGCTGATGCTGCCGCTCGCTGCTTCTGCAACGT
GCTGGGATGAGGCTGGGCGCGGCTACGGGATCGACCCCTTGCTGTTGAAGGCGATTGCCTGGAAGGAATC
GCGCGGCTGGACGGGTGCAGTCGGCCCGAAGCTGAAAGACGGCAACCGCGCGCTGGGCCTCATGCAGATC
AACACGATCCACCTGCCGAACCTCGCGCGCTTCGGCATCCGCCGTGAACACCTGTTCGACGCTTGCACCT
CGCAGAAGGTGGGGGCCTGGGTTCTGGCCGACTGCATCCAGCGTTTCGGCGCTACCTGGAAGTCCGTGGG
CTGCTACTACGCCGGTCCGGCATCGACCAATGTGAGCGCCCAGGTTGAGTACGTCCGCGACGTGCAGCGG
TTCTACGAGGGCTACCGCAGACAGCAAGCCCACCAAATTTCAACTTCACCGGCCCAAGTGGCCAGTTTCC
AAGGGGATTGA
 Primer design