SecReT4
Protein ID: 121582496
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4192
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]25708..28593 [-]
ProductTrwC protein
Component typeTraI_F
UniProt IDA1WDG8
KEGG IDajs:Ajs_4192
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 6.2e-92, Aligned region: 7..296
AAA_30 [PF13604], Evalue: 1.3e-48, Aligned region: 428..605
Viral_helicase1 [PF01443], Evalue: 3.8e-07, Aligned region: 448..573
PIF1 [PF05970], Evalue: 5.5e-07, Aligned region: 432..551
AAA_19 [PF13245], Evalue: 6.5e-07, Aligned region: 435..497
Protein Sequence: 961 a.a.     [Download]
>gi|121582496|ref|YP_974028.1| TrwC protein [Acidovorax sp. JS42]
MISMNNVGSAGQALHYFSADNYYTQDEGLEHSEWFGKGAEHLGLSGKIDRQAFFEVLNGKVDGQELGKWV
KNEETGEKEREHRPGTDMTFSAPKSVSLMAEVYGKRDVREAHEAAVKKALSHIETELARTRQTVDGKTEA
VQTGNVTVAMFRHNTSRDLDPQTHTHAVIMNATKREDGQWRSLTNEEIYNAQRVIGAIYTSELADRLQAL
GYDIRRTDEKGNFEIAGITREQIEHFSQRRAEIEAALKAKGVDIDDASAQQKEDATLKTRARKVDVDHEA
LIGSWKERAKDIGIDFDAIQAKADAQRAQGGVVRADKLTGREAMSFAAAHLIEREAVVSKNDLMAAAIEH
GAGRVSASEVKRAFDKLEKDGDLVALPDGNYTTKKMLGSEMWALDQVRAQKGQTPKMMEPEAVAARIAQA
EGRQGFKYSEGQKEAISKVLTTEDRYVAVQGLAGTGKTTMLKGVREMAQEQGYTVRGMAPTGAASKVLAR
ETGIATDTVSMFQIKERQLQKDIEFAKQYAPDFQRKAEVWIVDESSFLSQRQKAQLDHMAEKAGAKVVYL
GDTLQLQGVEAGKPFELAQRDGMETAYMTEINRQKTADLKQAVDIITGRDNLGDGQRLTQVELANNARAF
EYMDKAGMIREIPEKSEDDKGRLVAAVVQDILKLDKAERERTIVITAYNEDRRAINAGVREGLKEQGELS
RSEDTREIYTSKGWTRAMQKEAQYYKAGDVVRFGRDYQQIDAKKGEYMRVSAVDAPNGTVVLQKEDGSVI
AWQPKKHNKIEVYDRDTRELAKGDLIRITRNEGEFKNGEVARVTAVAGDKVTLELKQGKDVSLHQVDLSR
NKHWDHAYAQTVHASQGATQHRAIFHIRAPQTESEKKQERALENMAKVFGDRSFYVGATRASHELRIYTN
DKAVAAKAVAAKQDKTSAVETLRQHERATAITADKAGQRPVSPQRNGDVQR
 
Nucleotide Sequence: 2886 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c28593-25708 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGATTAGCATGAACAACGTGGGCAGCGCCGGGCAGGCACTGCACTACTTTTCCGCTGACAACTACTACA
CCCAGGACGAGGGCTTGGAGCATTCCGAGTGGTTCGGCAAGGGGGCCGAGCACCTTGGGCTTTCCGGCAA
GATTGATCGTCAAGCCTTCTTCGAGGTGTTGAACGGAAAGGTGGATGGCCAAGAGCTGGGCAAGTGGGTC
AAGAACGAGGAAACCGGCGAGAAGGAACGCGAGCACCGGCCGGGCACCGACATGACGTTTTCCGCGCCCA
AGAGTGTTTCTCTCATGGCCGAGGTGTACGGCAAGCGGGACGTGCGGGAGGCTCATGAGGCGGCCGTCAA
GAAGGCACTCAGCCACATCGAAACCGAGCTGGCCAGGACGCGGCAAACCGTGGACGGGAAGACCGAAGCG
GTGCAGACCGGCAACGTGACTGTGGCCATGTTCCGGCATAACACAAGCCGCGACCTCGACCCGCAGACGC
ATACGCACGCAGTAATCATGAACGCCACCAAACGGGAGGATGGGCAGTGGCGCTCCCTGACCAATGAAGA
AATCTACAACGCGCAGCGCGTTATCGGGGCCATCTACACGTCCGAGCTGGCCGACCGGCTCCAGGCGCTG
GGCTACGACATTCGCCGCACCGACGAGAAGGGCAACTTCGAGATTGCCGGTATCACCCGCGAGCAGATCG
AGCACTTCAGCCAGCGCCGGGCAGAAATAGAGGCGGCGCTGAAAGCCAAGGGCGTGGACATCGACGATGC
CAGCGCGCAGCAGAAGGAAGACGCCACGCTGAAGACCAGAGCGCGCAAGGTGGACGTGGATCATGAAGCC
TTGATCGGGAGCTGGAAGGAACGAGCCAAAGACATCGGGATCGACTTCGACGCCATCCAGGCCAAGGCCG
ACGCGCAACGGGCGCAAGGCGGTGTGGTGCGCGCTGACAAGCTCACCGGGCGCGAGGCGATGTCCTTTGC
GGCCGCACACCTGATCGAGCGCGAGGCCGTGGTATCCAAGAACGACCTCATGGCGGCGGCCATCGAGCAC
GGGGCAGGGCGCGTATCGGCATCGGAGGTGAAACGGGCCTTCGACAAGCTGGAGAAGGATGGTGATCTGG
TGGCCTTGCCTGACGGCAACTACACGACCAAGAAGATGCTGGGCAGCGAAATGTGGGCACTCGACCAAGT
GCGCGCACAGAAGGGCCAGACGCCGAAGATGATGGAGCCGGAAGCGGTGGCAGCGCGGATCGCGCAGGCC
GAGGGCCGGCAGGGCTTCAAATACAGCGAAGGCCAGAAGGAGGCCATCAGCAAGGTACTGACCACTGAAG
ATCGTTACGTGGCGGTGCAGGGCCTTGCCGGGACGGGTAAGACCACTATGCTCAAAGGCGTGCGCGAAAT
GGCGCAGGAGCAGGGCTACACGGTGCGCGGCATGGCTCCGACCGGGGCGGCCAGCAAGGTGCTGGCCAGG
GAGACAGGTATTGCTACTGATACCGTCTCGATGTTCCAGATCAAGGAGCGGCAGCTACAGAAGGACATCG
AGTTTGCCAAGCAGTACGCACCCGACTTCCAGCGCAAGGCGGAAGTCTGGATCGTGGATGAATCGTCCTT
CCTGTCGCAGCGCCAGAAGGCCCAGCTCGACCACATGGCCGAAAAGGCCGGGGCCAAGGTGGTGTACCTG
GGCGACACGCTCCAGTTGCAGGGTGTGGAGGCCGGCAAGCCCTTCGAGCTGGCCCAGCGGGACGGCATGG
AAACCGCGTACATGACCGAAATCAACCGCCAGAAGACCGCCGACCTGAAGCAAGCCGTGGACATCATCAC
TGGCCGCGACAACCTGGGGGACGGCCAGCGGCTCACCCAAGTGGAGCTGGCCAACAACGCGCGGGCCTTC
GAGTACATGGACAAGGCTGGAATGATCCGGGAAATTCCCGAGAAGTCCGAGGACGACAAGGGCCGCCTGG
TGGCGGCCGTAGTGCAGGACATCTTGAAGCTCGACAAGGCCGAGCGTGAGCGAACCATCGTCATTACCGC
CTATAACGAAGACAGGCGGGCCATCAATGCCGGCGTGCGCGAGGGACTGAAGGAACAGGGCGAACTGTCG
CGCTCCGAGGACACGCGCGAAATCTACACCTCGAAGGGGTGGACGCGGGCCATGCAGAAGGAGGCGCAAT
ACTACAAGGCCGGCGACGTGGTGCGCTTCGGGCGGGACTACCAGCAGATCGACGCCAAGAAGGGCGAATA
CATGCGCGTGTCGGCCGTGGATGCCCCCAATGGCACTGTGGTGCTCCAGAAGGAAGACGGCTCTGTGATC
GCATGGCAGCCGAAGAAGCACAACAAAATCGAGGTGTACGACCGCGACACCCGCGAGCTGGCCAAGGGCG
ACCTGATCCGTATCACCCGAAACGAAGGCGAGTTCAAAAACGGCGAGGTGGCGCGCGTCACGGCTGTGGC
CGGGGACAAGGTGACGCTGGAGCTGAAGCAAGGCAAGGACGTGTCATTGCACCAAGTGGATCTCTCTCGA
AACAAGCATTGGGATCATGCCTACGCGCAGACGGTTCACGCCTCCCAGGGTGCGACTCAGCACCGGGCCA
TCTTCCACATCCGAGCGCCTCAGACCGAGAGCGAGAAGAAGCAGGAGCGGGCGCTGGAGAATATGGCCAA
GGTCTTCGGGGATCGGAGCTTCTATGTCGGGGCCACGCGCGCCTCGCATGAGCTGCGCATCTACACCAAC
GACAAGGCGGTGGCGGCCAAGGCGGTGGCGGCGAAGCAAGACAAGACCAGTGCCGTGGAAACGCTCCGGC
AACACGAACGGGCCACGGCAATCACGGCCGACAAGGCGGGACAACGCCCGGTGTCGCCGCAGCGAAACGG
TGACGTTCAACGGTAA
 Primer design