SecReT4
Protein ID: 121582498
T4SS name [ID]Tra_F [525]
Gene symbol-
Locus tagAjs_4194
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO01 [GenBank: NC_008765] [Browse all T4SS(s) in this replicon]
Location [Strand]29057..31054 [-]
Producthypothetical protein
Component typeTraD_F
UniProt IDA1WDH0
KEGG IDajs:Ajs_4194
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.1e-146, Aligned region: 171..552
TraG-D_C [PF12696], Evalue: 4.3e-23, Aligned region: 411..533
T4SS-DNA_transf [PF02534], Evalue: 1.9e-17, Aligned region: 360..554
AAA_10 [PF12846], Evalue: 1.2e-12, Aligned region: 186..490
Protein Sequence: 665 a.a.     [Download]
>gi|121582498|ref|YP_974030.1| hypothetical protein Ajs_4194 [Acidovorax sp. JS42]
MAKREEKGSAGSFSRGAELWMHQARLFVVAIWTVVLISILAGLAVTTAYFWNATTADEKYALERNVLAHT
RDALYMTAGKMELNVNGELRKMEVSEVALLTDEMAEDAWRKLRNGGMFGLLTSIGVVFLISLYWWGYGRE
RMQDNQLRGAKLVEGKELARLIRHRDEASPYEIAGVPMRVKSETLHTLFAGAQGTGKSQQFFALMKQVRA
RGKRMIVYDPTGEFTQAFYREGKDILMNPLDSRSPNWNIWNEIAKDYHFDNMANGLIPDPAESDPFWALA
GRMVLKDVIAVLGREGRRTNRDLYNAIAKSNLDAMHALLQGTAGATYVDPTTERTGMSLKMTVQNQLEAF
RFLPDEGESFSIRKWVHEEGDSWMFITAREAMREALKPVLSLWIDTAIKAVLDLEPIHRERLWFCIDELP
TLQKLDILKLALTNTRKYGLCMVLGVQDFSQLYEIYGHDLAKTIISGCQTKLLLRVTDGAAAKLLAELMG
QAEVDEKDETLSYGLSSQRDGVSVMARRQMRDLVLTSEILTLPDMTGYLLVPGDYPIARVKYGYVPTEKQ
ANGFIERDGFAISFKPTTAAAAPAPAPSAAEVQQPAAPEQGDMLDDDDMDAPATVEVMRNENGDVIDKAT
GEIIKPAEKVSRAKDDADAKSAGQGKKPNPLADAL
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|121582466|ref|NC_008765.1|:c31054-29057 Acidovorax sp. JS42 plasmid pAOVO01, complete sequence
ATGGCAAAGAGAGAGGAAAAGGGAAGCGCCGGTAGCTTCTCCCGTGGGGCCGAGTTGTGGATGCACCAAG
CCCGGCTGTTCGTGGTGGCCATCTGGACGGTTGTGCTGATTTCCATCTTGGCCGGTCTGGCAGTCACGAC
CGCGTACTTCTGGAATGCGACTACCGCAGACGAAAAGTACGCGCTGGAGCGGAACGTCTTGGCGCACACG
CGGGATGCGCTCTACATGACGGCCGGAAAGATGGAGCTGAACGTCAACGGCGAGCTGCGCAAGATGGAAG
TTTCCGAGGTTGCCTTGCTGACCGACGAGATGGCCGAGGATGCTTGGCGAAAGCTGCGCAACGGCGGCAT
GTTCGGCTTGCTGACTTCCATCGGTGTGGTGTTTCTGATCTCTTTGTACTGGTGGGGCTATGGCCGTGAA
CGTATGCAGGACAACCAACTGCGCGGGGCCAAGCTGGTGGAAGGAAAGGAGCTTGCGCGACTGATCCGAC
ACCGCGACGAGGCAAGCCCTTATGAGATTGCGGGCGTGCCCATGCGCGTGAAGTCAGAGACGCTGCATAC
GCTGTTTGCCGGCGCGCAGGGTACGGGTAAGTCACAGCAGTTTTTCGCACTCATGAAACAGGTGCGGGCG
CGTGGCAAGCGGATGATCGTGTATGACCCGACCGGCGAGTTCACCCAGGCGTTCTACCGTGAAGGCAAAG
ACATCCTGATGAACCCGCTGGACTCCAGAAGCCCGAACTGGAACATCTGGAACGAAATCGCCAAGGACTA
CCACTTCGACAACATGGCGAACGGCCTGATCCCCGATCCGGCCGAGTCCGATCCATTTTGGGCGCTTGCG
GGCCGGATGGTGCTAAAGGACGTGATTGCAGTATTGGGGCGCGAGGGCCGCCGCACGAACCGCGACCTCT
ACAACGCTATCGCCAAGAGCAACCTGGACGCCATGCACGCATTGTTGCAGGGGACAGCGGGCGCAACCTA
TGTTGATCCCACGACCGAGCGCACGGGGATGTCACTCAAGATGACTGTTCAGAACCAGCTTGAAGCCTTC
CGGTTTTTGCCAGATGAGGGCGAATCGTTCTCCATCCGAAAATGGGTACATGAAGAAGGCGATTCATGGA
TGTTCATCACAGCACGGGAAGCGATGCGCGAGGCATTGAAGCCCGTTCTGTCGTTGTGGATCGACACGGC
AATCAAGGCCGTGCTTGACTTGGAGCCGATCCACCGCGAGCGGCTTTGGTTTTGCATTGACGAGCTGCCG
ACACTCCAAAAACTCGACATCCTGAAGCTGGCTCTGACGAACACACGGAAGTACGGTTTGTGCATGGTGC
TGGGCGTGCAGGACTTCAGCCAGCTCTACGAAATCTACGGGCACGATCTGGCCAAGACGATCATTTCCGG
GTGCCAAACGAAGCTGCTGCTGCGTGTGACGGATGGAGCTGCGGCGAAGCTGTTGGCCGAATTGATGGGA
CAGGCCGAGGTGGATGAAAAGGATGAAACCTTGAGCTACGGCCTCAGCTCGCAGCGTGACGGCGTGAGCG
TGATGGCGCGCCGACAGATGCGCGACCTTGTGCTGACATCGGAGATTTTGACGTTGCCCGATATGACCGG
CTATCTGCTGGTTCCGGGCGACTATCCCATTGCCCGCGTCAAGTATGGTTACGTGCCGACAGAGAAACAG
GCCAACGGCTTCATCGAGCGCGACGGCTTTGCGATCAGCTTCAAGCCGACCACGGCGGCCGCAGCGCCGG
CACCCGCTCCGTCCGCCGCTGAAGTTCAGCAGCCGGCCGCGCCGGAGCAGGGCGACATGTTGGATGACGA
CGATATGGACGCGCCGGCTACGGTGGAGGTTATGCGCAACGAAAATGGCGATGTGATCGACAAGGCAACC
GGCGAAATCATCAAGCCAGCCGAGAAGGTTTCGCGCGCGAAAGATGATGCAGATGCGAAATCAGCCGGCC
AGGGCAAGAAGCCCAACCCGCTGGCGGATGCGCTATAG
 Primer design