SecReT4
Protein ID: 121582569
T4SS name [ID]Trb [78]
Gene symbol-
Locus tagAjs_4264
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO02 [GenBank: NC_008766] [Browse all T4SS(s) in this replicon]
Location [Strand]13139..14872 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeTrbL
UniProt IDA1WDN8
KEGG IDajs:Ajs_4264
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.8e-38, Aligned region: 65..279
Protein Sequence: 577 a.a.     [Download]
>gi|121582569|ref|YP_974098.1| TrbL/VirB6 plasmid conjugal transfer protein [Acidovorax sp. JS42]
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQAAASGWAGVITTAATWLFWTLVVISMV
WTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQLAGNATGLGNALSPSGIVDV
GFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKVVLGVAAQLFAMVLLVGIGKTFLDDYYARMSAGISLKEMGVMLIVVIILLALTNKIPPLIAGII
TGASVGGAGIGQFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSA
FSGGGSSGGGSGGGGGDAGTGGTPFAQAAGFSGGSGGGSSSGGGSTSTGSSSGSSKGGEKGGDKAGAGGQ
GSGSTASTGNGADKAAKNEPKPAGGAGQGQQGGQQAAPGSTGPGLLASAASALGTAGRIAADAGANLAKG
TADVAKAKAASLREAAAERIADTTGGKIAAAIKAQGSGTAENIDVPDQQPAPSFGDNSLAGGPADADPES
EVAAFANREQGRDGTTA
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|121582553|ref|NC_008766.1|:c14872-13139 Acidovorax sp. JS42 plasmid pAOVO02, complete sequence
ATGAGAATGCCAGCCAATCTAAAAACCCTCGCCCTGCCGCTGTTCGTCTGGCTGGCGTTCTTCGCGGTCG
ATGCCCACGCGGCCATCGACAACGCCGGCGTGTTCGATAGCGTGCTGGATCGCTACCAGGCCGCCGCGAG
CGGCTGGGCCGGTGTCATCACCACGGCCGCAACCTGGCTCTTCTGGACGCTGGTTGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTTACCGGCTTCTTCTGGTGGGCGCTGACCAACGGCCCTAACTTCGCATCGTCCATCTATGCGTC
GTTGCGGCAGCTCGCCGGCAACGCGACGGGCCTGGGCAATGCGCTATCGCCCTCGGGCATCGTGGACGTG
GGCTTTGCGATCTTCGACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCCGTGGCGATCCTGGTCATCCTGGCCCTGGTCGGCGTCAACATGCTCCTGCTGCTCGCGTC
GGGCTGGGTGCTGGCCTACGGCGGCGTGTTCTTCCTCGGCTTCGGTGGTTCGCGTTGGACTTCCGACATG
GCGATCAACTACTACAAGGTCGTCCTGGGCGTGGCCGCGCAGCTCTTCGCAATGGTGCTCCTGGTGGGCA
TCGGCAAGACCTTCCTCGATGACTACTACGCGCGCATGAGCGCCGGCATCAGCCTCAAGGAAATGGGCGT
GATGCTGATCGTCGTCATCATCCTTCTGGCGTTGACCAACAAGATTCCGCCGCTCATCGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCCGGCATCGGTCAGTTCGGTGCAGGCGCTGCGCTGGGTGCCGCAGGCA
TGGCAGCAGCAGCGGCCGCCACTGGCGGCGCAGCTCTGGCCGCCGGCGCGGCCTCGGCCGCCGGCGGTGC
CTCGGCCGTCATGGCCGCCTTCTCGAAGGCCAATGAGAACGTGTCGGCAGGCACGGACGTGATGTCGGCC
TTCTCTGGTGGCGGCAGCTCGGGCGGTGGTTCAGGCGGTGGCGGTGGCGACGCCGGCACCGGCGGCACGC
CCTTCGCGCAGGCTGCGGGCTTTAGCGGCGGCTCCGGTGGCGGCTCGTCGTCGGGTGGCGGTAGCACCTC
GACCGGCAGCAGCTCGGGCAGCTCGAAGGGTGGCGAGAAGGGCGGCGACAAGGCCGGCGCCGGCGGCCAG
GGCAGCGGCTCGACCGCCAGCACCGGCAACGGTGCGGACAAGGCCGCCAAGAACGAACCCAAGCCCGCCG
GCGGGGCAGGGCAGGGGCAGCAGGGCGGCCAGCAGGCCGCGCCGGGCAGCACCGGCCCCGGCTTGCTCGC
GTCGGCCGCCTCGGCGCTCGGCACGGCCGGCCGCATCGCGGCCGACGCCGGCGCGAACTTGGCGAAGGGA
ACCGCCGATGTTGCCAAGGCCAAGGCCGCGAGCCTGCGCGAAGCCGCAGCCGAACGGATCGCCGACACCA
CCGGCGGAAAGATCGCCGCCGCGATCAAGGCGCAAGGAAGCGGCACGGCCGAGAACATCGACGTGCCCGA
CCAGCAGCCCGCGCCGAGCTTCGGCGACAACAGCCTGGCAGGCGGCCCAGCCGATGCCGATCCCGAGTCC
GAAGTAGCCGCGTTCGCCAACCGCGAGCAAGGCCGCGACGGCACAACTGCGTAA
 Primer design