SecReT4
Protein ID: 121582574
T4SS name [ID]Trb [78]
Gene symbol-
Locus tagAjs_4269
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO02 [GenBank: NC_008766] [Browse all T4SS(s) in this replicon]
Location [Strand]17816..18715 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA1WDP3
KEGG IDajs:Ajs_4269
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.5e-66, Aligned region: 73..298
Protein Sequence: 299 a.a.     [Download]
>gi|121582574|ref|YP_974103.1| conjugal transfer protein TrbG/VirB9/CagX [Acidovorax sp. JS42]
MKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIKPVAGSGG
AIKFVYGAQQPSIVCAVLQVCDVALQAGEQVNSINLGDTARWTVEPAITGSGATEVQHLIIKPMDVGLET
SLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGDLSFDYEL
SGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIVDTVFDRA
ILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 900 bp     [Download]
>gi|121582553|ref|NC_008766.1|:c18715-17816 Acidovorax sp. JS42 plasmid pAOVO02, complete sequence
ATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGCCCTCCCTGGCCCTGGCCGCCC
CTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCGACGCTGACCGCTCAAGAGCGCGCGGC
GCTCGCCATCGCCAAGCGGTGGGAAGCGGGGTCGGCGACCGGCATCAAGCCGGTGGCCGGCTCGGGCGGT
GCCATCAAGTTCGTGTACGGCGCGCAGCAGCCGAGCATCGTTTGCGCGGTGCTCCAGGTGTGCGACGTGG
CCTTGCAGGCCGGCGAACAGGTGAACTCGATCAACCTGGGCGACACGGCCCGGTGGACGGTCGAGCCGGC
CATCACCGGCAGCGGTGCGACCGAGGTTCAGCACCTCATCATCAAGCCGATGGACGTGGGCCTCGAAACC
AGCCTGGTCGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCTCGCATCGCACCGAGTACATGC
CGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGACGCGATCCAGCGCCGCGAGAAGCA
GGAACGCACCGACAACACCCTGCCGGCCACCGGCGAGTACCTGGGCGATCTCTCGTTCGACTATGAGCTG
TCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCAAGACCATCATCGAAATGCCCG
GCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGAGGGCGGCCTGTTCACCGACGA
CGAAACGGTGTTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTGGACACGGTGTTTGACCGCGCG
ATCCTGATTGCCGGTGTTGGCAGCAGCCAAGACCGCGTGACCATCAGCCGGAGGAAGTGA
 Primer design