SecReT4
Protein ID: 121582578
T4SS name [ID]Trb [78]
Gene symbol-
Locus tagAjs_4273
StrainAcidovorax sp. JS42
Repliconplasmid pAOVO02 [GenBank: NC_008766] [Browse all T4SS(s) in this replicon]
Location [Strand]22382..22846 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA1WDP7
KEGG IDajs:Ajs_4273
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.3e-19, Aligned region: 12..110
Protein Sequence: 154 a.a.     [Download]
>gi|121582578|ref|YP_974107.1| conjugal transfer protein TrbC [Acidovorax sp. JS42]
MQASLSAFRFNRSAMFYLGLFALLAFMMLAPHPAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFPG
EAVMRWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|121582553|ref|NC_008766.1|:c22846-22382 Acidovorax sp. JS42 plasmid pAOVO02, complete sequence
ATGCAAGCCTCTCTGTCGGCGTTCCGCTTCAACCGCAGCGCCATGTTCTACCTGGGCCTGTTCGCCCTCC
TGGCGTTCATGATGCTGGCCCCGCACCCCGCCTTCGCCTCCGAAGGCACCGGCGGTTCGCTGCCTTATGA
AAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCCTGATCTTCGGCGGTGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGTGCGCAGAACATGATGAGCACGTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGCGCTGCACCAGGTCAAGGTTGCCGCGCTGGACGTGGCCGGCTTCCCCGGT
GAGGCCGTCATGCGCTGGGCCGAACGCGGCCACATCGCGGGGTAA
 Primer design