SecReT4
Protein ID: 121582658
T4SS name [ID]Cjp [604]
Gene symbol-
Locus tagCJJ81176_pVir0001
StrainCampylobacter jejuni subsp. jejuni 81-176
Repliconplasmid pVir [GenBank: NC_008770] [Browse all T4SS(s) in this replicon]
Location [Strand]1..678 [+]
ProductVirB8
Component typeCjp01
UniProt IDQ9KIS2
KEGG IDcjj:CJJ81176_pVir0001
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.4e-31, Aligned region: 23..208
Protein Sequence: 225 a.a.     [Download]
>gi|121582658|ref|YP_980060.1| VirB8 [Campylobacter jejuni subsp. jejuni 81-176]
MAFIDDKKDPNFIFQLERNIKAYMLYIIIALTTIVVSLAIAITFLAPFKEVKPYLVFFSDGETNFVKVEQ
AGMDMRADENLLKSILAGYVKKRETINRVDDSERYEEIRLQSQKNVWETFSNLVKAPNSIYTTQGVFRSI
EIINVSIFNKNVATIDFIAKITNRDGSENHLKKYRATLFFDFIPMELTYNSVPKNPTGFIVKQYSITDII
DNDTFNNTQQTKGAK
 
Nucleotide Sequence: 678 bp     [Download]
>gi|121582657|ref|NC_008770.1|:1-678 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGGCTTTTATTGACGATAAAAAAGATCCAAATTTTATATTTCAACTTGAGAGAAATATAAAAGCGTATA
TGCTATACATTATTATAGCTTTAACTACGATTGTAGTTTCTCTTGCTATTGCCATTACTTTTCTTGCCCC
TTTTAAAGAAGTAAAGCCTTATTTAGTATTTTTTTCAGACGGCGAAACTAATTTTGTAAAGGTAGAACAA
GCAGGAATGGATATGAGAGCCGATGAGAATTTATTAAAATCAATTCTCGCAGGCTATGTTAAAAAACGCG
AAACGATAAATCGTGTCGATGATAGTGAGAGATACGAAGAGATCAGACTTCAATCTCAAAAAAATGTGTG
GGAAACATTCTCAAACTTAGTAAAAGCTCCAAATTCTATTTATACAACGCAAGGAGTTTTTAGAAGCATT
GAAATTATCAATGTTTCAATTTTTAATAAAAATGTAGCTACGATCGATTTTATAGCAAAAATAACTAATA
GAGATGGTAGTGAGAACCATTTAAAAAAATATCGTGCCACATTATTTTTTGATTTTATACCAATGGAGCT
TACTTATAATTCAGTTCCAAAAAATCCTACAGGCTTTATTGTCAAACAATATTCAATTACAGACATTATT
GACAATGATACTTTTAACAATACACAACAAACGAAAGGAGCGAAGTAA
 Primer design