SecReT4
Protein ID: 121582659
T4SS name [ID]Cjp [604]
Gene symbol-
Locus tagCJJ81176_pVir0002
StrainCampylobacter jejuni subsp. jejuni 81-176
Repliconplasmid pVir [GenBank: NC_008770] [Browse all T4SS(s) in this replicon]
Location [Strand]678..1748 [+]
ProductVirB9
Component typeCjp02
UniProt IDQ9KIS1
KEGG IDcjj:CJJ81176_pVir0002
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.7e-30, Aligned region: 132..347
Protein Sequence: 356 a.a.     [Download]
>gi|121582659|ref|YP_980061.1| VirB9 [Campylobacter jejuni subsp. jejuni 81-176]
MRKYSKIAFLALFVNLTAFADNIQIQDVPNPNANTGESILQTKEQALNNYTQTNIKIDPLGNQGQGQRID
NSSYANPQYQAQAFDTYSQSNGEQLSEEQIALMKSAIRNQNLNALQQRFFQKKYSGFENTLNLDYQPNKT
QKIRTRFAMATTLIFETDITNYILGDTTGFKVEEIPSMPNAIAIKPMLIGIDTSLTIFTKDNKLHTFYIF
STDYKNSKDPSLVIYIHDQNSKELIKEKQEKLAKDYLIIKEGIAEVRVKKSEIYNHYSQKAKKGDEWLIS
EEIFNDKKFTYFKYDKDKMPQVPAIFAVIDKQDSPVETRIIGNYVIAETTAKKFTIKSGDSYVCVERLDQ
NKKAKK
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|121582657|ref|NC_008770.1|:678-1748 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGAGAAAATATTCAAAAATAGCTTTTCTAGCTTTATTTGTAAATTTGACAGCTTTTGCTGACAACATAC
AAATTCAAGATGTTCCTAACCCTAATGCAAACACAGGCGAAAGCATTTTACAAACTAAGGAACAAGCTTT
AAATAATTATACACAAACCAATATCAAAATAGATCCTTTAGGAAATCAAGGGCAAGGGCAAAGAATAGAT
AATTCAAGTTATGCTAATCCACAATATCAAGCCCAAGCTTTTGATACTTACTCTCAAAGCAATGGAGAAC
AGTTAAGCGAAGAGCAAATTGCTTTAATGAAAAGTGCGATTAGAAACCAAAATTTAAATGCTTTACAGCA
AAGATTTTTTCAAAAAAAATATTCAGGATTTGAAAACACATTAAATCTTGATTATCAGCCCAATAAAACG
CAAAAAATAAGAACACGCTTTGCAATGGCAACCACTCTTATTTTTGAAACGGATATTACAAATTATATCT
TAGGAGATACGACAGGATTTAAGGTAGAAGAAATTCCAAGTATGCCTAATGCCATAGCTATTAAACCTAT
GCTAATCGGAATTGATACTTCTTTGACTATTTTTACCAAAGACAATAAACTTCACACCTTCTACATCTTT
TCGACTGATTATAAAAATAGCAAAGATCCTTCTTTAGTAATTTATATACACGATCAAAATTCAAAAGAAT
TAATTAAAGAGAAACAAGAAAAATTGGCAAAAGATTACTTAATCATTAAAGAAGGTATTGCTGAAGTTCG
TGTTAAAAAAAGTGAAATCTATAATCACTATAGCCAAAAAGCAAAAAAAGGCGACGAGTGGCTTATTAGC
GAAGAAATTTTCAATGATAAAAAATTTACTTATTTCAAATACGACAAAGACAAAATGCCACAAGTCCCAG
CAATATTTGCAGTAATTGATAAACAAGACAGTCCAGTAGAGACTAGGATCATCGGTAATTATGTAATTGC
TGAAACCACTGCAAAAAAATTTACAATCAAAAGTGGAGATAGTTATGTATGTGTAGAGCGTTTGGATCAA
AACAAAAAGGCTAAGAAATGA
 Primer design