SecReT4
Protein ID: 121582660
T4SS name [ID]Cjp [604]
Gene symbol-
Locus tagCJJ81176_pVir0003
StrainCampylobacter jejuni subsp. jejuni 81-176
Repliconplasmid pVir [GenBank: NC_008770] [Browse all T4SS(s) in this replicon]
Location [Strand]1745..2881 [+]
ProductVirB10
Component typeCjp03
UniProt IDQ9KIS0
KEGG IDcjj:CJJ81176_pVir0003
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5e-50, Aligned region: 183..362
Protein Sequence: 378 a.a.     [Download]
>gi|121582660|ref|YP_980062.1| VirB10 [Campylobacter jejuni subsp. jejuni 81-176]
MKKSFLSLSLATILLSNNLFAEDIFDQTSEENVSKNISKKDNQSQNLLNKEDLDYLFKNSDTKFPVTDYI
YKGGFKEPNEDIKIHSEEKPKKEEDNNITKLAKIEEKKQELIQKNQQIAKEIHQDNISSQERKIKKLIRD
SILADRGNTQIYFQENSSKYGVDGFSNQKSIDVSTNEHRLYRMIRAGRLIPALLTSAISSDLQGIVTAQI
EQDIYASMGNAVLIPRGSKAIGFYKNDNKIGQNRLEIQWREIITPQGVNILLTNALASDNMGMAGAVGSV
NNKYLERYGMPYALSTISNVLLLSIASKAGNNNYAQEVYSQSKNDVSTIVDDIIQQQSQIKPTIEIKSGS
RIFIVPTNHMWFAKPKNNEVLIQYFQDN
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|121582657|ref|NC_008770.1|:1745-2881 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGAAAAAATCATTTTTAAGCCTAAGTCTTGCAACAATATTGTTAAGCAACAATCTTTTTGCAGAAGATA
TATTTGATCAAACAAGCGAAGAAAATGTATCTAAAAATATATCTAAAAAAGACAATCAAAGCCAAAATTT
GCTTAACAAAGAAGATTTAGACTATCTTTTCAAAAATTCAGATACAAAATTTCCAGTCACCGATTATATT
TATAAGGGCGGATTTAAAGAACCTAACGAAGATATTAAAATTCATAGTGAAGAAAAACCTAAAAAAGAAG
AAGATAATAATATTACTAAGTTAGCAAAAATTGAAGAAAAAAAGCAAGAACTGATACAAAAAAATCAGCA
AATTGCAAAAGAAATTCATCAAGATAATATTAGTTCTCAAGAAAGAAAAATCAAAAAACTTATCAGAGAT
AGTATTTTAGCTGATCGTGGCAACACGCAAATTTATTTTCAAGAAAATTCTTCAAAATACGGCGTTGATG
GTTTTTCAAACCAAAAAAGCATAGATGTTTCAACAAACGAACACCGTCTTTATAGAATGATAAGAGCAGG
AAGATTAATTCCTGCCCTTTTAACGAGTGCTATTTCTAGTGATTTGCAAGGTATAGTAACCGCTCAAATA
GAGCAAGATATATATGCAAGTATGGGAAATGCAGTGTTAATTCCACGCGGAAGTAAGGCTATAGGATTTT
ACAAAAACGACAACAAAATAGGACAAAATCGCTTAGAAATACAATGGAGAGAAATTATTACACCACAAGG
CGTTAATATACTTTTAACCAATGCTTTAGCTAGTGATAATATGGGTATGGCAGGAGCAGTTGGAAGCGTT
AATAATAAATATCTTGAAAGATACGGAATGCCTTACGCACTCTCCACAATTTCAAATGTATTGCTTCTTA
GCATAGCGTCAAAAGCAGGAAATAATAATTACGCTCAAGAAGTTTATTCTCAAAGTAAAAACGATGTATC
TACGATAGTAGATGATATTATCCAACAACAAAGCCAGATTAAACCAACAATCGAAATTAAATCAGGAAGT
AGAATTTTTATAGTTCCTACCAATCATATGTGGTTTGCAAAACCTAAAAACAACGAAGTATTGATCCAAT
ATTTCCAAGATAATTAA
 Primer design