SecReT4
Protein ID: 121582662
T4SS name [ID]Cjp [604]
Gene symboltrbB
Locus tagCJJ81176_pVir0005
StrainCampylobacter jejuni subsp. jejuni 81-176
Repliconplasmid pVir [GenBank: NC_008770] [Browse all T4SS(s) in this replicon]
Location [Strand]3085..4038 [+]
Productconjugative transfer regulon protein
Component typeCjp05
UniProt IDQ9KIR9
KEGG IDcjj:CJJ81176_pVir0005
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4e-48, Aligned region: 20..294
FtsK_SpoIIIE [PF01580], Evalue: 8.8e-05, Aligned region: 138..164
Protein Sequence: 317 a.a.     [Download]
>gi|121582662|ref|YP_980064.1| conjugative transfer regulon protein [Campylobacter jejuni subsp. jejuni 81-176]
MSNNTIVLNNILNVLKPYLEMEANELIFNKPCEIKVDKGDVWETIYDDRLNYNFLETFLIELAIKRNQRF
DEKHCHLSCELPYPFLRYRVQAQHKTSLFNSEICICIRIPSKSRFALENFVLNDKCLEKGWTYEKIKDLI
KNKKNVLVSGGTGSGKTSFLNSLMGEIDPNERIVTIEDAQELYIENENKTQLAVPKEESEIYSYQTAINN
AMRLRPDRLFLGEIDIRNTFTFLRVNNTGHAGNLSTLHANNPEDAIKAIITNIILGGGLQNPDNKMLTEL
IITAIDFIIQISRNKKTGTRDITDILDLKNDYAKLLI
 
Nucleotide Sequence: 954 bp     [Download]
>gi|121582657|ref|NC_008770.1|:3085-4038 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGAGTAATAATACTATTGTTTTAAATAATATTTTAAATGTTTTAAAACCTTACTTAGAAATGGAAGCAA
ACGAGCTTATTTTTAATAAACCTTGTGAAATCAAGGTAGATAAAGGCGATGTTTGGGAAACTATTTATGA
TGATAGGCTCAATTATAATTTTTTAGAAACCTTTTTAATTGAACTTGCTATTAAAAGAAATCAGAGATTT
GATGAAAAACATTGTCATCTCTCTTGTGAGTTGCCTTACCCCTTTTTAAGATATAGGGTGCAAGCACAGC
ACAAGACAAGTCTTTTTAATTCTGAAATTTGTATTTGTATCAGAATACCTTCAAAAAGTCGTTTTGCACT
TGAAAATTTTGTTTTAAACGATAAGTGTTTAGAAAAAGGTTGGACTTATGAAAAAATTAAAGATTTAATT
AAAAATAAAAAGAATGTTTTAGTCTCAGGTGGAACAGGAAGTGGAAAAACTAGCTTTTTAAATTCTTTAA
TGGGTGAAATTGATCCAAATGAAAGAATTGTAACTATTGAAGACGCTCAAGAATTATATATCGAAAACGA
GAACAAAACCCAATTAGCCGTGCCAAAAGAAGAAAGTGAAATCTATTCCTATCAAACGGCGATAAATAAC
GCTATGAGATTAAGACCTGATAGATTATTTTTAGGAGAAATTGATATCAGAAACACCTTTACATTTTTAA
GGGTAAATAACACAGGACACGCAGGAAACTTAAGCACTCTGCACGCAAATAATCCAGAAGACGCGATCAA
AGCTATTATCACAAATATTATTTTAGGTGGGGGCTTACAAAACCCTGATAATAAAATGCTTACTGAACTA
ATTATAACGGCTATAGATTTTATTATACAAATTTCGAGAAATAAAAAAACAGGGACTAGAGATATTACAG
ATATTTTAGATTTGAAAAATGATTACGCAAAATTATTAATCTAA
 Primer design