SecReT4
Protein ID: 121582710
T4SS name [ID]Cjp [604]
Gene symbol-
Locus tagCJJ81176_pVir0053
StrainCampylobacter jejuni subsp. jejuni 81-176
Repliconplasmid pVir [GenBank: NC_008770] [Browse all T4SS(s) in this replicon]
Location [Strand]34862..37330 [+]
ProductVirB4
Component typeCjp53
UniProt IDQ8GJA2
KEGG IDcjj:CJJ81176_pVir0053
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.9e-30, Aligned region: 211..409
AAA_10 [PF12846], Evalue: 1.2e-28, Aligned region: 466..742
TrwB_AAD_bind [PF10412], Evalue: 7.8e-10, Aligned region: 635..775
AAA_17 [PF13207], Evalue: 9.3e-06, Aligned region: 471..555
Protein Sequence: 822 a.a.     [Download]
>gi|121582710|ref|YP_980112.1| VirB4 [Campylobacter jejuni subsp. jejuni 81-176]
MGTSIFTYLKELKNKPKKENLGKKEKKNFKEYINKINRGADNILMLAEPKIFTMAKENNIAFKLDENILV
TKDGNLCVGIEIKGISYSGISLEEEISYLQSRTQFFGKISSDIEINLIVKKDRIELVKQNSNSKNVFANQ
IIEKWENHKDAFQITYFLIISTIDKKISGALESFKNKTTKEKEQSKEEKESFSFEAKKIIINETLTEAKR
ALSIFNPTQITADDILNFYATYSNAQETKFRYTNELITDSYISSNVEFKKDYILFERNDGKQMFSRFISI
KAYETDIISSHITTKILRSSSDFIIFMNMQAYEKEKAIKKVKDTGAFAPQIIKDELSGLIEIIKADRENL
MLVSFSVYILAENLEDLETKTNELKGILANQNLNIVRETINQKALYFSFFPSRANLNARKRTLKVSNLAS
IANFEKDVLGFAKNDWGEQPVTIFRHLSGTPYLFNFHWTDQGDKPSGHTMIIGGTGAGKTTLAQFLMCNL
YKYDIDIFSMDKLRGMYNFATYTDGEYHDADFSDFKLNPFALPYTSENKSFLQNFIQKMANIEDTQYNAV
NEISKTIERLYNNKLEEDIFTLSDFIDSLQYEENDIKGRLRPFQNSIFDNKQDALSFNKQLSILNMDSIL
KNPTLASLTASYIFHRLKNSAKNSKKRGFFCFIDELKDFLMDENMRESILESILEVRKIGGVMCMGFQNL
SFFDDIPKGASFLENIANYIIFPTTNAQTLENMRNKLNLTPTELKFLQEAGTNSRQVLLKMNLSNQSAIL
NIDLSRLGKHLRVFSSSSDNVMLMKELKELYPNDWRNMYLENQKPNLNQGAK
 
Nucleotide Sequence: 2469 bp     [Download]
>gi|121582657|ref|NC_008770.1|:34862-37330 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGGGAACGAGTATTTTTACTTATTTAAAAGAACTTAAAAATAAACCTAAAAAAGAAAATTTAGGAAAGA
AAGAAAAGAAAAATTTCAAAGAATATATCAATAAAATAAATAGGGGTGCTGACAATATTTTAATGTTAGC
AGAACCAAAAATTTTTACAATGGCTAAAGAAAATAACATAGCTTTTAAGCTTGATGAAAATATTTTAGTT
ACAAAAGATGGAAATTTATGTGTTGGAATTGAGATCAAAGGAATTTCTTATTCCGGAATTTCTTTAGAAG
AAGAAATATCTTATCTTCAAAGCCGAACACAATTTTTTGGAAAAATTAGTTCTGATATAGAAATCAATTT
GATTGTTAAAAAAGATAGAATTGAATTAGTAAAGCAAAATTCTAACTCCAAAAATGTTTTTGCCAATCAA
ATTATAGAAAAATGGGAAAATCATAAAGACGCTTTCCAAATAACTTACTTCCTAATCATATCAACTATTG
ACAAAAAAATAAGTGGAGCTTTGGAAAGTTTTAAGAACAAAACAACCAAAGAAAAAGAGCAAAGTAAGGA
AGAAAAAGAAAGTTTTAGTTTTGAAGCTAAAAAAATTATCATAAATGAAACTTTGACTGAAGCAAAAAGA
GCTTTGTCTATATTTAATCCAACTCAAATCACGGCTGATGATATTTTAAATTTCTATGCAACCTACTCAA
ACGCACAAGAAACTAAATTTAGATATACAAACGAACTAATCACTGATAGTTACATTAGCTCTAATGTAGA
ATTTAAAAAAGATTATATTTTATTTGAAAGAAATGATGGAAAACAAATGTTTTCAAGGTTTATAAGCATT
AAAGCTTATGAAACTGACATAATATCTTCTCATATAACTACAAAAATTCTAAGAAGCTCCAGTGATTTTA
TAATTTTTATGAATATGCAAGCTTATGAAAAAGAAAAGGCGATAAAAAAGGTAAAAGACACAGGAGCATT
TGCACCACAAATCATAAAAGATGAACTTAGCGGACTTATTGAAATAATAAAAGCCGATAGAGAAAATTTA
ATGCTTGTGAGCTTTTCAGTTTATATTTTGGCTGAAAATTTAGAAGATTTAGAAACTAAAACAAACGAGC
TTAAAGGAATTTTAGCAAACCAAAACCTAAACATCGTTCGAGAAACCATAAATCAAAAGGCTTTATACTT
CTCATTTTTTCCAAGCAGAGCAAACTTAAACGCTAGGAAAAGAACCCTAAAGGTTTCAAATTTAGCTAGC
ATAGCCAATTTTGAAAAAGATGTCTTAGGTTTTGCAAAAAATGATTGGGGCGAACAGCCAGTAACTATTT
TTAGACATTTAAGTGGAACTCCTTATCTTTTTAATTTTCATTGGACGGATCAAGGAGATAAGCCAAGCGG
ACATACTATGATTATAGGTGGAACAGGTGCAGGAAAAACAACATTAGCTCAATTTTTAATGTGTAATCTT
TATAAGTATGATATTGATATTTTTTCTATGGATAAGCTTCGCGGTATGTATAATTTCGCAACTTATACAG
ACGGAGAGTATCACGACGCTGATTTTAGTGATTTTAAACTAAATCCGTTTGCATTGCCTTATACAAGTGA
AAATAAGTCTTTTTTACAAAACTTTATTCAAAAAATGGCTAATATAGAAGACACTCAATACAATGCCGTA
AATGAAATTTCAAAGACTATAGAAAGGCTTTATAATAATAAACTTGAAGAAGATATCTTTACCTTAAGCG
ATTTTATCGACAGTCTTCAGTACGAAGAAAATGATATTAAAGGACGACTAAGACCTTTTCAAAATAGTAT
TTTTGATAATAAGCAAGATGCTTTAAGTTTCAACAAACAATTATCAATTCTAAATATGGATAGCATTTTA
AAAAATCCTACACTAGCAAGCCTAACGGCTTCTTACATATTTCATAGGTTAAAAAATTCAGCAAAAAATT
CAAAAAAAAGAGGCTTTTTTTGTTTTATCGATGAGCTTAAAGATTTTTTAATGGACGAAAATATGAGAGA
AAGCATACTTGAAAGTATTCTTGAAGTAAGAAAAATAGGTGGAGTAATGTGTATGGGTTTTCAAAACTTA
AGCTTTTTTGATGATATTCCAAAGGGTGCAAGCTTTTTAGAAAATATAGCAAACTATATTATTTTTCCAA
CAACGAACGCACAAACGCTTGAAAATATGAGAAATAAGCTTAATTTAACACCGACAGAGCTTAAATTTTT
GCAAGAAGCAGGAACAAATTCAAGGCAAGTTTTATTAAAAATGAACCTGTCAAATCAATCGGCTATTTTA
AATATAGATCTTAGTCGTTTAGGAAAGCATTTAAGAGTATTCTCATCATCAAGCGATAATGTAATGCTTA
TGAAGGAGCTTAAAGAACTTTATCCAAACGATTGGAGAAATATGTATCTTGAAAATCAAAAACCAAATTT
AAATCAAGGAGCTAAATAA
 Primer design