SecReT4
Protein ID: 121582776
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4193
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]69719..71710 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA1VUZ8
KEGG IDpna:Pnap_4193
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.1e-104, Aligned region: 112..558
TrwB_AAD_bind [PF10412], Evalue: 8.1e-31, Aligned region: 172..539
TraG-D_C [PF12696], Evalue: 2.2e-30, Aligned region: 404..524
AAA_10 [PF12846], Evalue: 2.6e-07, Aligned region: 219..480
Protein Sequence: 663 a.a.     [Download]
>gi|121582776|ref|YP_973218.1| conjugal transfer coupling protein TraG [Polaromonas naphthalenivorans CJ2]
MQGTSVLFGQVLTVFGIVLAGVWGATQWTAAALGYQLRLGTPWFDFFGTPVYHPWRLFEWWFFFDAYAPH
IFNTGGSIAGASGMVSVVVAIGMSIWRSRQSKLVTTYGSARWADAKEIRKAGLTNPAGVFLGLHDDQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWNITAGWRSRFSHCLLFNPTDPKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALERRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
CPFEVTLHRMMSTRHLGESTHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLISAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGVERKHKLLLMLDEFPALGRLDFF
ESALAFMAGYGLRAFLISQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDESVVMVSGHAPIKAKKLRYYLDANFKRRVLPPPA
LTLGRYADVPAARADDWSALAVPTVSAASATAGLGESLDDGGPRQQPELSEVATYSPEPDQSASDLSLLD
DDDFPLPLPNQLDPRLQRTARLAALDPDDGIQL
 
Nucleotide Sequence: 1992 bp     [Download]
>gi|121582711|ref|NC_008757.1|:69719-71710 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGCAAGGGACCAGTGTGCTGTTCGGTCAGGTGTTGACGGTGTTCGGCATCGTCTTAGCCGGCGTGTGGG
GTGCCACACAATGGACCGCCGCTGCCCTGGGTTACCAGCTACGCCTTGGCACTCCCTGGTTCGATTTCTT
CGGTACGCCGGTCTATCACCCTTGGCGTTTGTTCGAGTGGTGGTTCTTCTTCGACGCTTACGCACCGCAT
ATCTTCAACACGGGTGGCAGCATCGCTGGCGCCAGCGGCATGGTCTCGGTGGTGGTCGCCATCGGCATGT
CGATCTGGCGCTCGCGGCAGTCCAAGCTGGTCACAACTTACGGGTCCGCACGCTGGGCCGATGCCAAAGA
AATCCGCAAGGCGGGATTGACCAATCCAGCCGGTGTTTTCCTCGGCCTGCATGACGATCAGTACCTGCGC
CATGAAGGGCCGGAACATGTCCTGACCTTCGCGCCCACACGCTCGGGCAAAGGCGTGGGTCTGGTGGTGC
CGACGCTGTTGTCATGGCCTGCATCTGCCGTTATCCACGACATCAAGGGCGAGAACTGGAACATCACCGC
TGGCTGGCGCTCACGCTTCTCGCACTGCCTGCTGTTTAACCCGACCGATCCGAAGTCGGCTGCATACAAC
CCACTACTGGAAGTCCGACGCGGCGCGCATGAAGTGCGCGACGTGCAGAACATCGCCGACATCCTGGTCG
ATCCCGAAGGGGCACTGGAACGGCGCAACCACTGGGAGAAGACTTCGCACGCTCTGCTGGTCGGCGCGAT
CTTGCATGTGCTCTATGCGGGCGAAGACAAGACGCTGCGCGGCGTCGCCAACTTCCTGTCAGATCCGGCG
TGCCCGTTCGAGGTGACGTTGCACCGGATGATGAGCACGCGGCACTTGGGCGAGAGCACCCATCCTGTTG
TCGCATCCGCCGCACGCGAAGTTCTCAACAAGTCGGACAACGAGCGCTCGGGCGTGCTGTCCACGGCCAT
GAGTTTTCTGGGATTGTATCGCGACCCCACCGTGGCCGAAGTGACTTCGCGTTGCGACTGGCGCATCGCC
GACCTGATCTCTGCCGAGCATCCAGTGTCGTTGTACCTGGTGGTGCCGCCTTCAGACATCAGTCGCACCA
AGCCGCTGATCCGGCTGATCCTGAACCAGATTGGTCGGCGGCTCACCGAATCGCTCGATGGTTCCGATGG
TGTGGAGCGCAAGCACAAGCTGCTGCTGATGCTCGATGAGTTCCCGGCATTGGGCCGGCTGGACTTCTTT
GAATCGGCACTGGCATTCATGGCTGGCTACGGCCTGCGCGCCTTCCTGATTTCACAGTCGCTCAACCAGA
TCGACAAAGCCTACGGCCAGAACCATTCGATTCTGGACAACTGCCATGTGCGCGTGACCTTCGCCACCAA
CGACGAACGCACTGCGAAACGCATCTCCGAAACGCTGGGCACGGCCACCGAGCTGCGCGCGCAGCGCAAC
TACGCCGGCCATCGGCTGGCGCCGTGGCTGGGCCACCTGATGGTGTCACGCCAGGAGACCGCGCGGCCAC
TGTTGACGCCTGGCGAAGTCATGCAACTGCCGCCCGATGAATCGGTGGTGATGGTCTCCGGCCATGCCCC
GATCAAGGCCAAGAAGCTGCGCTACTACCTTGACGCCAACTTCAAGCGACGCGTACTCCCGCCGCCCGCG
CTGACATTGGGCCGTTATGCCGACGTGCCAGCGGCACGCGCCGACGACTGGAGCGCCTTGGCTGTGCCTA
CGGTGTCGGCCGCTTCGGCGACGGCTGGGCTTGGCGAATCGCTCGATGACGGCGGCCCGCGTCAGCAGCC
CGAGCTATCCGAAGTCGCCACCTACAGCCCCGAACCCGATCAGTCGGCCAGCGACCTGTCGCTGCTTGAT
GACGACGACTTTCCGCTTCCCCTCCCAAACCAGCTCGACCCGCGCTTGCAGCGCACGGCACGGCTGGCCG
CTCTCGACCCTGACGACGGAATCCAGCTATGA
 Primer design