SecReT4
Protein ID: 121582778
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4195
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]72156..73187 [+]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDA1VV00
KEGG IDpna:Pnap_4195
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.3e-82, Aligned region: 31..297
TrwB_AAD_bind [PF10412], Evalue: 1.1e-05, Aligned region: 153..190
Protein Sequence: 343 a.a.     [Download]
>gi|121582778|ref|YP_973220.1| type II secretion system protein E [Polaromonas naphthalenivorans CJ2]
MSAVLKDQPPSSAATSLDRRIRMLRTAMGPLIAAALEDPDVVEIMLNPDGSLWIDRLSSGRSPMGVKLSE
ADGERIIRLVAAHVGTEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKRAVSIIGLERYVADSIL
SEEQAEFLRRAVRERLNILIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVSLRTRAG
VVSMAELVRATMRLRPDRVIVGEVRGGEALDLIKVWGTGHPGGIATIHASSAHGALLRLEQLILEVALTP
PRALIAEAVNVIVFIAGRGRGRHVQTIARVVGFDVHGYQLDDALAPPLPTLSLPSSTTPGELP
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|121582711|ref|NC_008757.1|:72156-73187 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGAGCGCCGTCCTGAAAGACCAGCCGCCATCATCCGCTGCCACATCACTGGATCGGCGTATCCGCATGT
TGCGTACGGCGATGGGACCGCTGATCGCTGCCGCGCTGGAAGATCCGGACGTGGTGGAGATCATGCTCAA
CCCGGATGGCTCCTTGTGGATTGATCGGCTGTCGTCGGGCCGCTCGCCGATGGGCGTCAAGCTGTCCGAG
GCCGATGGCGAACGCATCATCCGGCTGGTTGCCGCCCATGTCGGCACCGAGGTGCATCGCGGCCAGCCGT
TGCTGACGGCCGAACTGCCGGAAACGGGTGAGCGCTTCGAGGGCATCTTGCCACCCGCTGCGCCGGGGCC
GGCCTTTGCCTTGCGTAAGCGCGCCGTGAGCATCATTGGGCTGGAGCGCTATGTCGCCGACAGCATCCTG
TCCGAGGAACAAGCCGAGTTCCTGCGCCGCGCGGTCCGCGAGCGGCTAAACATCCTGATCGCTGGGGGTA
CCAGCACTGGCAAGACCACGCTGGCCAACGCGCTGTTGGCCGAGATTGCCGCCACTGGCGACCGGGTGCT
GGTGCTCGAAGACACCGTGGAGCTGCAGTGTGCCGCCCGCGACCACGTATCGCTGCGCACCCGCGCTGGC
GTGGTGTCGATGGCGGAGCTGGTGCGGGCCACGATGCGGCTGCGGCCCGACCGCGTGATCGTCGGCGAGG
TGCGCGGCGGTGAGGCACTGGACCTCATCAAGGTCTGGGGCACCGGGCACCCCGGCGGCATCGCCACGAT
CCACGCCAGTTCCGCTCACGGCGCGCTACTGCGCTTGGAACAACTGATCCTCGAAGTCGCTTTGACACCG
CCGCGTGCGCTGATCGCCGAGGCGGTGAATGTCATTGTTTTCATCGCCGGGCGCGGCCGTGGCCGCCATG
TGCAGACCATCGCCCGCGTTGTCGGTTTCGACGTCCACGGCTACCAGCTCGACGACGCGCTCGCGCCGCC
GCTTCCAACTCTTTCGCTTCCTTCCTCAACCACCCCTGGAGAACTGCCATGA
 Primer design