SecReT4
Protein ID: 121582779
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4196
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]73184..73543 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA1VV01
KEGG IDpna:Pnap_4196
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.7e-25, Aligned region: 17..108
Protein Sequence: 119 a.a.     [Download]
>gi|121582779|ref|YP_973221.1| conjugal transfer protein TrbC [Polaromonas naphthalenivorans CJ2]
MTHIAFSTSRFSANPHLRLTLHVVVLAALMLCLTLPAHAAGSSMPWEGPLTSILESIQGPVARIVAVIII
ISTGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVVA
 
Nucleotide Sequence: 360 bp     [Download]
>gi|121582711|ref|NC_008757.1|:73184-73543 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGACGCACATCGCTTTTTCGACTTCCCGTTTTTCTGCAAATCCGCATCTGCGGCTGACGTTGCACGTTG
TCGTGCTCGCCGCGCTGATGCTGTGCCTGACTTTGCCGGCACATGCAGCCGGCTCCAGCATGCCTTGGGA
AGGGCCGCTGACATCCATCCTCGAATCAATCCAGGGACCGGTGGCCCGGATCGTCGCGGTCATCATCATC
ATTTCCACCGGCTTGGCGCTGGCCTTCGGCGATACGTCGGGCGGCTTCCGCAAGCTGATCCAGATCGTGT
TCGGTCTGTCTATTGCGTTCGCCGCGTCCTCGTTCTTCCTGTCGTTCTTCTCGTTCTCGGGCGGGGCGGT
GGTCGCATGA
 Primer design