SecReT4
Protein ID: 121582780
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4197
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]73540..73824 [+]
Productputative conjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDA1VV02
KEGG IDpna:Pnap_4197
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 9.6e-11, Aligned region: 1..87
Protein Sequence: 94 a.a.     [Download]
>gi|121582780|ref|YP_973222.1| putative conjugal transfer TrbD transmembrane protein [Polaromonas naphthalenivorans CJ2]
MSTETEFAQGFASGFEIPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGLVLWIVGHSLAVW
GARLDPQFMAVFSRHIKHRPLLDV
 
Nucleotide Sequence: 285 bp     [Download]
>gi|121582711|ref|NC_008757.1|:73540-73824 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGAGCACCGAGACCGAATTTGCACAGGGCTTCGCCAGTGGTTTCGAGATTCCGCTGCATCGGTCCTTGA
CCGAACCGATCCTGCTGGGCGGCGCGCCGCGCACCGTGGCGATCGCCAACGGGACGCTGGCCGCCGCCGT
TGGTCTGGGCCTGCAACTGTGGATTCCCGGCCTGGTGCTGTGGATCGTCGGCCATTCGCTGGCGGTCTGG
GGTGCACGGCTCGATCCGCAGTTCATGGCCGTGTTTTCACGGCACATCAAACATCGCCCACTGCTGGACG
TGTAA
 Primer design