SecReT4
Protein ID: 121582781
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4198
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]73846..76287 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA1VV03
KEGG IDpna:Pnap_4198
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.7e-35, Aligned region: 442..715
CagE_TrbE_VirB [PF03135], Evalue: 3.7e-16, Aligned region: 181..388
DUF853 [PF05872], Evalue: 2.2e-07, Aligned region: 599..687
Protein Sequence: 813 a.a.     [Download]
>gi|121582781|ref|YP_973223.1| conjugal transfer ATPase TrbE [Polaromonas naphthalenivorans CJ2]
MMNLAEYRKRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSAQLNNALRRLG
SGWALFVEAERRAAADYPYSDFPEPLSWLVDEERRASFEEDHSHFESGYHLTLAYLPAEESRVRAAKLLY
ENTPQRGVDWRERLESFISETDRFFDLLDGVMPEIVWLDDSQTLTYLHATVSARRYRVAVPEHPFYLDAL
LADSALVGGLAPMLGDQHLRVASVRGFPTSTWPGLLDDLNRLGFAYRWSTRFLCMDKADAETELGRLRRQ
WFAKRKNVVALLRETIFQQESPLVDTDASNKANDADAALQELGSDQVAFGYVTATVTVLDPDSSVADEKL
RRIERVIQGRGFVTIPETLNAVEAWLSSIPGNAYANVRQPIISTLNLAHLMPVSAVWAGPERNNHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVVGPTGMGKSVLLATLAMQFRRYPGSRIFAFDMGRSMRATTLGLG
GEHYDLGKGWEEGGEIAFQPLARIDQDGYRTWAAEWLEGRLLHEGAAVGPEEKAMVWSALGSLAGAPVEQ
RTLTGLSVLLQSNALRQALQPYVLGGAHGKLLDADSDRLGSGSVQCFEMEELMHSKAAVLAVLGYLFARF
DERFDGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIQNSSIAPAIVESCASRI
FLPNPQATEPQIRTIYEGFGLNRRQIDIVAEAVPKRDYYYQSRLGNRLFDLDLGPVTLAFAGASTPQDQR
DIDAVSRSESSSDFAAAWLRHRGLDWAADLVPSFPSIPQENAP
 
Nucleotide Sequence: 2442 bp     [Download]
>gi|121582711|ref|NC_008757.1|:73846-76287 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGATGAATCTCGCTGAATACCGCAAACGTCCCGCACTGCTGGCCGATTGGTTGCCCTGGGCCGGGCTGG
TTGCGCCGGGCGTTGTGCTCAACAAGGATGGCTCGTTCCAGCGCACGGCGCGCTTTCGCGGGCCGGACCT
GGACAGCGCCACGCAGGGCGAACTGATCGCCACGTCCGCGCAGCTGAACAATGCGCTGCGCCGGTTGGGG
TCAGGCTGGGCCTTGTTCGTGGAGGCCGAACGGCGCGCCGCTGCCGACTACCCGTACTCGGATTTTCCGG
AGCCGCTGTCCTGGCTGGTGGACGAAGAACGGCGGGCTTCGTTCGAGGAAGACCACAGCCACTTCGAGAG
CGGCTACCACCTGACGCTGGCGTACCTGCCCGCTGAGGAATCTCGCGTCCGCGCGGCCAAGCTGCTGTAC
GAGAACACGCCACAGCGCGGCGTGGACTGGCGCGAGCGGCTGGAGTCGTTCATCTCTGAGACGGATCGTT
TTTTCGACTTGCTCGATGGGGTCATGCCGGAGATCGTCTGGCTGGACGACAGCCAGACCTTGACCTACCT
GCATGCGACGGTTTCGGCGCGGCGCTACCGGGTGGCGGTGCCGGAACATCCGTTCTACCTCGATGCCTTG
CTGGCCGATTCCGCGCTGGTCGGAGGTTTGGCCCCGATGCTGGGTGACCAGCACCTACGGGTGGCGTCGG
TGCGCGGTTTCCCCACCTCGACCTGGCCGGGTCTCCTGGACGACTTGAACCGCCTGGGCTTCGCCTACCG
CTGGTCCACACGCTTTCTCTGCATGGACAAGGCCGACGCGGAAACGGAGTTGGGCCGACTGCGCCGCCAG
TGGTTCGCCAAGCGCAAAAACGTGGTGGCCTTGCTGCGCGAAACCATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGATGCCTCGAACAAGGCCAACGATGCCGATGCCGCTTTGCAGGAACTGGGCAGCGATCAAGT
CGCCTTCGGCTATGTTACTGCCACGGTGACGGTGCTCGATCCAGATTCTTCGGTGGCCGATGAAAAACTG
CGTCGGATTGAACGTGTCATCCAAGGCCGCGGTTTCGTCACGATCCCGGAAACGCTCAATGCCGTGGAGG
CGTGGCTGTCCTCGATTCCGGGTAATGCCTACGCCAACGTGCGACAGCCCATCATCTCGACGCTAAATCT
GGCGCACCTGATGCCAGTGTCGGCCGTATGGGCCGGGCCGGAGCGCAATAACCATTTGGACGGGCCGCCG
CTGATCGTGACGCGCACCGATGGCGCCACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTGGTCGGGCCGACTGGTATGGGCAAGTCGGTGCTGCTGGCTACCTTGGCGATGCAGTTCCGCCG
CTATCCCGGTTCGCGCATCTTTGCCTTCGACATGGGTCGCTCGATGCGCGCCACCACCCTGGGACTGGGC
GGCGAACATTACGACCTGGGCAAAGGATGGGAGGAAGGTGGCGAAATCGCCTTCCAGCCGCTGGCCCGCA
TCGACCAGGACGGCTACCGCACCTGGGCCGCCGAATGGCTGGAAGGCCGCTTACTGCATGAAGGCGCAGC
CGTCGGCCCGGAAGAAAAGGCCATGGTCTGGTCGGCGCTGGGAAGTCTGGCGGGCGCACCGGTGGAGCAG
CGCACCCTGACCGGGCTGTCGGTACTGCTGCAATCGAATGCCTTGCGCCAGGCCTTGCAGCCTTACGTGC
TGGGCGGCGCGCACGGCAAGCTGCTGGATGCGGATTCGGATCGCTTGGGTTCTGGTTCCGTCCAGTGCTT
CGAGATGGAAGAGCTGATGCATAGCAAGGCCGCCGTGCTGGCCGTGCTGGGCTATCTGTTCGCCCGCTTC
GATGAGCGGTTCGACGGCGCGCCGACCTTGCTCATTCTGGACGAGGCCTGGCTGTTTCTGGATGACCCGG
TGTTTGCCGCGCGCATCCGCCAGTGGCTCAAGACGCTGCGCAAAAAGAACGTCAGTGTGATCTTCGCTAC
GCAATCGCTGGCCGACATCCAGAACTCGTCCATCGCCCCGGCCATCGTGGAGAGCTGCGCCAGCCGCATC
TTCCTGCCGAATCCGCAGGCGACCGAACCACAGATTCGCACGATCTACGAAGGCTTTGGTTTGAACCGTC
GCCAGATCGACATCGTGGCCGAGGCGGTTCCCAAACGCGACTACTACTACCAGTCCCGGCTGGGCAATCG
CTTGTTTGACCTGGACCTGGGGCCGGTCACGCTGGCCTTTGCCGGTGCTTCGACACCGCAGGACCAACGC
GACATTGATGCGGTATCCCGCTCGGAGTCGTCTTCCGACTTCGCAGCCGCCTGGCTGCGCCATCGCGGCC
TTGACTGGGCCGCCGACCTTGTTCCGTCCTTTCCATCCATTCCACAGGAGAACGCACCATGA
 Primer design