SecReT4
Protein ID: 121582782
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4199
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]76284..77012 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA1VV04
KEGG IDpna:Pnap_4199
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 3.5e-12, Aligned region: 2..41
Protein Sequence: 242 a.a.     [Download]
>gi|121582782|ref|YP_973224.1| conjugal transfer protein TrbJ [Polaromonas naphthalenivorans CJ2]
MKKTILAIAAAALVTLMPVAHAQWVVIDPSNLAQNIMTAARTLEQINNQIRQLQNQAQSLMNQAKNLTGL
DFSALNELRASLSATNQLIQQAQGLAFNVSQMETEFQRLYPDAYSASISGTQMTTDARSRWRNSLEALRT
ATKVQSQAVQNFASDEQTLTDLVNRSQSAVGALQATQATNQLLALQARQSIQAQQLQITQDRATALEQAR
VIAAQERAREVRRRFLGEGTPYTPQTIDFYRN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|121582711|ref|NC_008757.1|:76284-77012 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGAAAAAGACCATCCTCGCCATTGCCGCCGCAGCGTTGGTGACCCTGATGCCCGTCGCACACGCGCAGT
GGGTCGTGATCGATCCGTCCAACCTGGCCCAGAACATCATGACGGCCGCGCGCACGCTGGAGCAGATCAA
CAACCAGATCAGGCAGCTCCAGAATCAGGCGCAGTCGCTGATGAACCAGGCGAAGAACCTCACCGGTCTG
GACTTCAGCGCGTTGAATGAACTGCGTGCGTCGCTGTCGGCGACCAACCAGCTTATCCAGCAGGCGCAAG
GCCTGGCGTTCAACGTGTCGCAAATGGAGACCGAATTCCAGCGGCTCTACCCTGATGCGTATTCCGCCTC
CATCTCGGGAACTCAGATGACGACCGACGCGCGTTCGCGCTGGCGCAACTCGCTTGAAGCGTTGCGCACC
GCGACCAAGGTGCAGTCGCAAGCCGTACAGAACTTCGCCTCCGATGAGCAGACGCTGACGGACTTGGTGA
ACCGCAGCCAGTCGGCGGTCGGCGCTTTGCAGGCCACACAGGCGACCAACCAGTTGCTGGCCTTGCAGGC
GCGGCAGTCGATCCAGGCGCAGCAACTGCAAATCACGCAGGACCGCGCCACCGCGCTGGAACAGGCGCGT
GTCATCGCGGCGCAGGAACGTGCGCGCGAAGTGCGCCGCCGCTTCCTGGGTGAGGGCACGCCGTATACGC
CGCAGACCATCGATTTCTACAGGAACTGA
 Primer design