SecReT4
Protein ID: 121582783
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4200
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]77023..78396 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA1VV05
KEGG IDpna:Pnap_4200
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.9e-47, Aligned region: 38..264
Protein Sequence: 457 a.a.     [Download]
>gi|121582783|ref|YP_973225.1| conjugal transfer protein TrbL [Polaromonas naphthalenivorans CJ2]
MNDISVIDRFLNVFSRYIDSGFGLLGGEVAFLTATLVAIDMTLAGLFWAMSHASGGGDDIIGKLIKKVLY
VGAFAYIIGNFNLLAGILFRSFAGLGLVASGSTITQAEFLQPGRLAKVGIDAGAPILEQISAMAGFPEVF
VNLDAITVMLLAWLVVVMSFFVLAVQLFVTLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGIK
VLVLAVIVGIGTGLFAEFQVTPDEPSIDHALTIMLAALAMLGLGIFGPGIATGLVSGAPQLGAGAVAGTA
LGVAGAAVAVGAAATGVGGAVAAGARMAPGAAKMAASGARSMASTASSAKSAFQAGSAGAGGGLKGAAAG
LGNVAKTGAQSVGQKVAAGAKSMKDRTAAAIKPDASASGTGAGAGAGSAAQGGNDAAPTDTQQPAWAKSL
HRRQQISHAASTVAHTLRGGDGGGSGSSPSLRDPSDS
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|121582711|ref|NC_008757.1|:77023-78396 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGAACGACATTTCCGTCATCGACCGATTCCTCAATGTTTTCTCGCGTTACATCGATTCTGGTTTCGGTC
TGCTGGGCGGCGAAGTTGCGTTCCTGACCGCCACGCTGGTGGCAATCGACATGACACTGGCCGGTCTGTT
CTGGGCGATGAGCCATGCCAGCGGTGGCGGCGACGACATCATCGGCAAGCTCATCAAGAAGGTGCTGTAC
GTGGGTGCCTTCGCCTACATCATCGGCAACTTCAACCTGCTGGCCGGCATCCTGTTCCGATCTTTCGCAG
GCTTGGGATTGGTGGCGTCGGGTTCGACCATCACCCAGGCCGAGTTCCTGCAGCCGGGGCGGCTGGCCAA
GGTCGGCATCGATGCCGGGGCGCCCATCCTGGAGCAGATCAGCGCGATGGCGGGCTTCCCCGAGGTATTC
GTGAACCTCGATGCCATCACGGTGATGCTGCTGGCCTGGCTGGTGGTGGTCATGAGTTTCTTCGTGCTGG
CGGTGCAGCTCTTCGTCACGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGCTTCGTGCTGGTGCCGTT
CGCACTGTGGAACAAGACCTCGTTTCTCGCTGAAAAGGTGTTGGGCAACGTGGTGTCGTCAGGCATCAAG
GTGCTGGTGCTGGCGGTCATCGTAGGGATTGGCACGGGGTTGTTTGCCGAATTCCAGGTGACGCCGGATG
AACCCTCCATCGACCACGCACTGACCATCATGTTGGCTGCACTGGCGATGCTGGGTCTTGGGATCTTCGG
GCCAGGCATCGCGACTGGGCTGGTATCTGGGGCACCGCAGTTGGGTGCAGGTGCTGTTGCCGGAACCGCA
TTGGGTGTCGCGGGAGCAGCGGTTGCCGTGGGTGCTGCCGCCACCGGCGTGGGCGGTGCGGTGGCTGCCG
GTGCGCGTATGGCGCCGGGTGCCGCAAAGATGGCCGCGAGCGGTGCCCGCTCGATGGCCTCGACCGCCAG
CAGCGCGAAGTCCGCGTTCCAGGCCGGCTCTGCCGGTGCAGGTGGTGGACTCAAGGGTGCGGCAGCAGGA
TTGGGCAACGTCGCCAAGACGGGCGCGCAATCGGTGGGGCAGAAGGTCGCTGCCGGAGCCAAGTCGATGA
AGGACCGGACTGCGGCGGCCATCAAGCCGGATGCCTCGGCATCCGGGACTGGCGCTGGTGCCGGAGCTGG
CTCGGCCGCTCAAGGCGGCAACGATGCCGCACCCACAGATACCCAGCAACCCGCGTGGGCCAAGAGCCTG
CATCGCCGCCAGCAGATCAGCCATGCCGCTTCGACCGTCGCCCACACGCTGCGCGGTGGAGACGGCGGCG
GCTCGGGCAGTAGCCCCAGCCTGCGCGACCCCTCGGATTCCTAA
 Primer design