SecReT4
Protein ID: 121582784
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4201
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]78409..79113 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA1VV06
KEGG IDpna:Pnap_4201
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.8e-60, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|121582784|ref|YP_973226.1| conjugal transfer protein TrbF [Polaromonas naphthalenivorans CJ2]
MRFKRSLVRYADTPQPATPYQSAEQVWDDRIGSSRVQAKNWRLMAFGCLVLALLMAGGLVWRSAQSIVTP
FVVEVDSGGQVRAVGEAATPYKPNDAQTAHHLGRFVTLVRSLSIDPIVVRQNWLDAYDYTTDRGAAVLND
YARTNDPFARIGKESVTVQITSIVRASEASFNVRWTERRYVNGAAAGLERWTAVVSIVLQTPRTEERLRR
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|121582711|ref|NC_008757.1|:78409-79113 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGCGATTCAAACGCTCATTGGTGCGGTATGCGGACACGCCGCAGCCTGCCACCCCGTACCAATCCGCCG
AACAGGTCTGGGACGACCGTATCGGTTCATCTCGCGTGCAGGCAAAGAACTGGCGGTTGATGGCTTTCGG
TTGCCTGGTGCTGGCCTTGCTGATGGCTGGCGGTTTGGTCTGGCGCTCGGCGCAGTCCATCGTCACACCC
TTTGTGGTGGAGGTGGACAGCGGCGGGCAGGTGCGCGCTGTCGGTGAAGCGGCCACGCCCTACAAGCCGA
ACGATGCGCAGACGGCCCATCACTTGGGGCGCTTCGTCACGCTGGTGCGCTCGCTGTCCATTGACCCCAT
CGTCGTGCGGCAGAACTGGCTGGATGCCTATGACTACACCACCGACCGGGGTGCTGCGGTACTCAACGAC
TACGCACGCACCAACGATCCCTTTGCCCGCATTGGCAAAGAGTCGGTGACGGTGCAGATCACCAGCATCG
TGCGCGCCAGCGAGGCATCGTTCAACGTGCGTTGGACCGAGCGCCGCTATGTCAACGGCGCAGCTGCTGG
ACTGGAGCGCTGGACCGCTGTTGTGTCCATCGTCCTTCAAACGCCGCGCACCGAGGAACGGCTGCGCCGC
AATCCGCTGGGCATCTACGTCAATGGGTTGTCGTGGAGCCGTGAACTCGATTCTTCCGAAGGAGCCAAAC
CATGA
 Primer design