SecReT4
Protein ID: 121582785
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4202
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]79110..80123 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA1VV07
KEGG IDpna:Pnap_4202
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.2e-67, Aligned region: 107..326
Protein Sequence: 337 a.a.     [Download]
>gi|121582785|ref|YP_973227.1| conjugal transfer protein TrbG/VirB9/CagX [Polaromonas naphthalenivorans CJ2]
MKPSLRIYVFLSLLVATSMTLSGCATPGKPPPTITLDEPVAAQPLPELPKPVEVVAVPQPLPLPEQLKLL
PDELEAKTAPESADEKVRVTRANQEARIAPTREGYVNAIQVWPFTDGALYQVYASPGRVTVVSLQPGEEL
VTVAAGDTVRWIVGDTSSGAGASLRVSVLVKPTRSGLKTNLVVTTNRRTYLIELTSTEKAWMASVSWDYP
KDRMLALQRQAQAAQIAAPVDAGLSLEKIRFRYAITGSNPPWKPLRAFDDGEKVYIQFPGGIAQGELPPL
FVIGAQGDGQLVNYRFRSPYYIVDRLFGAAELRLGADKGDVVRIERTDGTVSGTRRN
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|121582711|ref|NC_008757.1|:79110-80123 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGAAACCGTCTTTGCGCATTTACGTATTTCTGTCTCTACTGGTCGCCACATCAATGACCCTCTCGGGCT
GCGCCACGCCGGGCAAGCCGCCGCCGACCATCACGCTCGATGAGCCGGTTGCGGCGCAGCCGCTACCCGA
GTTGCCCAAGCCCGTCGAAGTGGTCGCGGTTCCGCAGCCTTTGCCATTACCCGAGCAGTTGAAGCTGTTG
CCGGATGAGCTGGAGGCCAAGACGGCACCTGAATCGGCCGACGAGAAGGTACGCGTTACGCGGGCCAATC
AGGAGGCCCGCATTGCACCGACGCGAGAGGGCTACGTCAATGCGATCCAGGTCTGGCCGTTCACTGATGG
CGCGCTGTACCAAGTCTATGCCAGTCCTGGCCGGGTGACGGTGGTTTCGCTCCAACCCGGCGAGGAACTG
GTGACGGTTGCCGCTGGTGACACCGTGCGCTGGATCGTGGGCGACACGTCCAGCGGCGCGGGGGCCAGTC
TGCGCGTGAGCGTTCTGGTCAAGCCCACGCGCAGCGGTCTCAAAACCAATCTGGTCGTGACCACCAACCG
GCGCACCTACCTGATTGAGCTGACCTCGACCGAGAAGGCATGGATGGCATCCGTGTCCTGGGACTATCCG
AAGGACCGCATGCTGGCCTTGCAGCGCCAGGCGCAGGCGGCACAGATTGCCGCACCGGTCGATGCGGGCC
TGTCGTTGGAGAAAATCCGTTTCCGCTACGCCATCACGGGCAGCAATCCACCCTGGAAGCCGCTGCGCGC
CTTTGACGATGGCGAGAAGGTCTATATCCAGTTCCCTGGCGGCATTGCGCAGGGCGAGCTACCACCGCTG
TTCGTCATCGGCGCGCAGGGGGACGGCCAACTCGTGAACTACCGTTTCCGTTCGCCGTACTACATCGTAG
ACCGGCTGTTCGGCGCGGCCGAACTGCGCCTGGGCGCTGACAAAGGTGACGTGGTGCGGATCGAGCGCAC
GGATGGGACTGTGAGCGGGACGCGGAGGAACTGA
 Primer design