SecReT4
Protein ID: 121582786
T4SS name [ID]Trb [323]
Gene symbol-
Locus tagPnap_4203
StrainPolaromonas naphthalenivorans CJ2
Repliconplasmid pPNAP01 [GenBank: NC_008757] [Browse all T4SS(s) in this replicon]
Location [Strand]80126..81445 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA1VV08
KEGG IDpna:Pnap_4203
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.4e-57, Aligned region: 243..425
Protein Sequence: 439 a.a.     [Download]
>gi|121582786|ref|YP_973228.1| conjugation TrbI family protein [Polaromonas naphthalenivorans CJ2]
MSQANNAPDTPDSAVPDVPPKVAPENVTLRSQPRPVTRLNRRMLAVLAGGLATAVLGGTIWSLQSTQRRG
AGDQKELYNVDRVSRSEGLDRLPADYSKLPPTLPAPVPQLGAPLPGDLGGPIHKAEQQAQGYGYQQPGHD
PAEVERLARLKQAEEAAASSVFFRSGGQKVAAAAQPQALPVATALAANAAFDPMAAGPASTAAQSADPTA
VQNRQDQKEAFLSKAGSTETRNSGSLQMSASPYQVMAGTVIAAALVTGIKSDLPGDVIATVTEPVYDTAT
GKYVLIPQGSRLLGKYNSQVSYGQSRVQVVWNRVILPDTSSFQLDKLIGTDPAGYAGLEDGVDWHWDRVF
AGAALTTLLGIGAELAAPENRNGGDRVIIAGRDSLKDSVNQAGQEMTRRNMNMQPTLTERPGLPVRVIVN
RDLVLRPYQPLFFVRGGLR
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|121582711|ref|NC_008757.1|:80126-81445 Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence
ATGAGCCAAGCGAACAATGCCCCTGATACCCCAGATTCCGCAGTGCCAGACGTGCCGCCCAAAGTGGCCC
CGGAAAACGTGACGCTGCGCTCCCAGCCGCGTCCAGTTACGCGCCTGAACCGACGCATGCTGGCCGTCCT
CGCTGGAGGGCTGGCGACCGCCGTACTCGGTGGCACTATCTGGTCGTTGCAATCAACGCAGCGCCGTGGC
GCTGGCGACCAGAAGGAGTTGTACAACGTTGATCGCGTGTCGCGCTCGGAAGGGCTTGATCGACTGCCAG
CGGACTATTCCAAGCTGCCGCCGACCCTGCCAGCCCCAGTGCCACAACTCGGTGCGCCGCTGCCAGGCGA
CTTGGGTGGCCCGATCCACAAGGCCGAGCAACAGGCGCAGGGTTATGGCTATCAGCAGCCCGGCCATGAT
CCGGCCGAGGTTGAGCGCCTGGCGCGTTTGAAGCAGGCCGAGGAAGCGGCGGCGTCTTCAGTGTTCTTCC
GTTCGGGTGGTCAAAAGGTGGCCGCAGCCGCGCAGCCGCAGGCCTTGCCTGTGGCCACCGCGTTGGCCGC
GAATGCCGCCTTTGATCCGATGGCCGCTGGCCCGGCATCGACTGCCGCGCAGTCGGCTGACCCCACTGCG
GTGCAGAACCGGCAAGACCAGAAGGAGGCGTTTCTGTCCAAAGCCGGTTCTACGGAAACCCGTAATTCCG
GCTCCCTGCAAATGTCCGCATCGCCGTATCAAGTCATGGCGGGCACGGTGATCGCCGCCGCGCTGGTCAC
GGGCATCAAGTCCGACCTGCCGGGCGATGTGATCGCCACGGTGACGGAGCCGGTCTACGACACGGCCACC
GGCAAGTACGTGCTGATCCCGCAGGGCTCGCGCCTGCTGGGCAAGTACAACAGCCAGGTGAGTTATGGAC
AGAGCCGCGTGCAGGTGGTGTGGAATCGGGTCATCCTGCCGGATACGTCCTCGTTCCAGCTCGACAAGCT
GATCGGTACCGATCCGGCGGGCTATGCGGGTCTGGAAGATGGTGTGGACTGGCATTGGGATCGCGTCTTT
GCCGGTGCTGCGCTGACGACCTTATTGGGCATCGGTGCCGAGCTGGCCGCACCGGAGAATCGCAATGGCG
GCGATCGCGTAATCATCGCCGGACGCGACAGCCTGAAGGACTCTGTAAACCAAGCGGGCCAAGAGATGAC
CCGGCGAAATATGAACATGCAGCCGACGCTAACCGAGCGACCCGGCTTGCCGGTGCGCGTCATCGTCAAC
CGGGATCTGGTGCTGCGACCGTACCAACCACTTTTCTTTGTGCGTGGGGGATTGCGATGA
 Primer design