SecReT4
Protein ID: 121583594
T4SS name [ID]VirB [473]
Gene symbol-
Locus tagVeis_5019
StrainVerminephrobacter eiseniae EF01-2
Repliconplasmid pVEIS01 [GenBank: NC_008771] [Browse all T4SS(s) in this replicon]
Location [Strand]3988..6264 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDA1WSU8
KEGG IDvei:Veis_5019
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-102, Aligned region: 95..557
TraG-D_C [PF12696], Evalue: 1.3e-25, Aligned region: 398..517
PLDc_2 [PF13091], Evalue: 8.1e-18, Aligned region: 613..729
TrwB_AAD_bind [PF10412], Evalue: 1.3e-14, Aligned region: 375..528
Protein Sequence: 758 a.a.     [Download]
>gi|121583594|ref|YP_980116.1| TRAG family protein [Verminephrobacter eiseniae EF01-2]
MSKKKIAIAVLVLLLLAVASVFGMLYVTSGLLVKYLSLGDVTPHLSLPFELAKFGAKKEKGFGVIALVAS
IGLPVLLFGLVGYAALTPKKRELHGSARFATRQELVKGGLLQPDQADDKYPSIVVGKQDKDFLLFRGQQF
MFLAAPTRSGKGVGIVIPNLLHYRDSVVVLDIKGENFEITSGFRAKCGQEVHKFAPDDENFQTACWNPLA
YVRDDPRFRISDLMGITNILYPPSDDVWASTAESLFLGLALYIMDTSKLHGSFNMATIKKMRVGLGCLKD
EEAFMAHVKERKPFEPLSEDCITHLRSFAQTSDKLRNSIGISFDQPLGIFSDPITAKATASNSFDMRDVR
KKRMSIYVVVKPANIDKFGKFLNLFFQQLLVLNMDKLPQDDPSLKYQCLLLLDEFPAMGRIAIIEKASAY
MAGYNMRLLLVFQSKSQVKDRKLYDETGAQTMLTNMALQVVYAPRDDDDAKDYSEMIGYMTEKGLSKSRQ
LGAKSGRSESESDQRRAVMLPQEVKAIGMAKEIISMENMPPALVDKIFWYQEPIFQARANLPQPAVPDQS
ELLNTIEPAPPSPVLHFAGAVEEQALPTGATFEVGFSPKRNALEVVMSFVLGAKTELLVAAYSFTSKDIA
FALVEAKARGIDVRVVVDHAQNTDDQGGYKAVDYLSSQGIPVFRCENYAAMHHKFMVADGLHVQLGSFNY
TSSANLRNAETAVAFRNAPELASVYRTEWLRLSTEPKASVETVMAVDRGLAILKEFGI
 
Nucleotide Sequence: 2277 bp     [Download]
>gi|121583590|ref|NC_008771.1|:c6264-3988 Verminephrobacter eiseniae EF01-2 plasmid pVEIS01, complete sequence
ATGAGCAAGAAAAAAATAGCCATCGCCGTCCTGGTGCTGCTGCTGTTGGCCGTGGCATCCGTCTTTGGGA
TGCTCTACGTGACCTCGGGCCTGCTGGTGAAGTACCTGAGCCTGGGCGACGTGACCCCGCATCTGTCCTT
GCCCTTCGAGCTGGCGAAGTTCGGCGCGAAGAAGGAAAAGGGCTTTGGCGTTATCGCGCTGGTGGCCAGC
ATCGGCCTGCCGGTGCTGCTGTTCGGCCTGGTCGGCTACGCGGCGCTTACCCCAAAAAAGCGGGAGTTGC
ACGGCTCGGCGCGGTTTGCCACGCGGCAAGAGCTGGTCAAGGGTGGGTTGCTTCAACCCGACCAGGCGGA
CGACAAGTACCCCTCCATCGTGGTGGGCAAGCAAGACAAGGATTTTTTGCTGTTCCGTGGCCAGCAATTC
ATGTTCCTGGCTGCGCCGACACGCTCCGGCAAGGGCGTTGGCATCGTGATTCCCAACCTGCTCCACTACC
GGGATTCGGTGGTGGTGCTGGACATCAAGGGCGAGAACTTCGAGATTACTTCGGGCTTCCGTGCGAAGTG
CGGGCAGGAAGTCCATAAGTTCGCGCCTGATGACGAGAACTTTCAAACTGCCTGCTGGAACCCGCTGGCC
TACGTGCGCGATGACCCGCGCTTTCGCATCAGCGACTTGATGGGCATAACCAACATCCTGTACCCGCCAA
GTGATGACGTGTGGGCCTCCACGGCTGAAAGCCTGTTCCTCGGCCTGGCGCTCTACATCATGGACACGTC
GAAGCTGCACGGCAGTTTCAACATGGCCACGATCAAGAAAATGCGTGTCGGCCTGGGCTGTTTGAAGGAC
GAAGAAGCCTTCATGGCTCACGTCAAGGAACGTAAGCCGTTCGAGCCGCTTTCTGAGGACTGCATAACCC
ACCTGCGCAGCTTCGCGCAGACCAGCGACAAGCTGCGCAACAGCATTGGCATTTCGTTCGATCAGCCGTT
GGGCATTTTCAGTGACCCAATCACTGCAAAGGCCACGGCCTCGAATAGCTTCGATATGCGCGACGTGCGC
AAAAAGCGCATGAGCATCTACGTGGTGGTCAAGCCCGCCAACATTGACAAGTTCGGCAAGTTCTTGAACC
TGTTTTTCCAACAGCTTCTCGTGCTGAACATGGACAAGCTGCCGCAGGATGACCCCAGCCTGAAATACCA
ATGCCTGTTGCTGCTCGATGAGTTCCCGGCGATGGGGCGCATCGCCATCATTGAGAAGGCATCGGCGTAC
ATGGCCGGGTACAACATGCGCTTGCTGCTGGTTTTTCAGAGCAAGAGCCAGGTCAAAGACCGCAAGCTGT
ACGACGAAACCGGCGCTCAAACCATGTTGACCAACATGGCGTTGCAGGTTGTCTATGCCCCCCGCGACGA
TGACGACGCGAAGGACTACAGCGAGATGATCGGCTACATGACCGAAAAGGGCTTGTCGAAGTCTCGCCAG
CTCGGCGCGAAGTCGGGCCGCAGCGAGTCGGAAAGCGATCAGCGCCGGGCTGTGATGCTGCCCCAGGAAG
TGAAGGCCATAGGCATGGCCAAAGAGATCATCAGCATGGAGAACATGCCCCCGGCGCTGGTGGACAAAAT
CTTTTGGTATCAAGAGCCGATTTTTCAGGCTCGGGCAAACCTCCCGCAACCTGCGGTGCCTGACCAAAGC
GAGCTGCTCAACACGATTGAGCCTGCACCGCCCTCCCCTGTCCTGCATTTCGCGGGTGCGGTTGAAGAGC
AAGCGTTGCCCACCGGGGCGACGTTTGAAGTTGGCTTCTCACCGAAGCGCAACGCGCTTGAGGTGGTCAT
GTCGTTTGTGCTCGGCGCAAAGACGGAACTTCTGGTGGCTGCGTACTCGTTCACCAGCAAGGACATTGCC
TTTGCGTTGGTTGAGGCCAAGGCACGCGGCATTGATGTTCGCGTGGTGGTCGATCACGCGCAAAACACCG
ACGATCAGGGCGGCTATAAGGCCGTCGATTACCTGTCGTCGCAAGGCATCCCGGTTTTCCGGTGCGAGAA
CTACGCGGCGATGCACCACAAGTTCATGGTGGCTGACGGCCTGCATGTGCAGCTCGGGAGCTTCAACTAC
ACGTCTTCCGCGAATCTGCGCAACGCCGAAACGGCGGTGGCATTCCGCAACGCGCCCGAGCTGGCCAGCG
TGTACCGGACTGAGTGGCTGCGACTGTCCACTGAACCCAAAGCCTCGGTTGAAACGGTCATGGCCGTTGA
CCGTGGCTTGGCCATCCTCAAGGAATTTGGAATTTAA
 Primer design