SecReT4
Protein ID: 121583595
T4SS name [ID]VirB [473]
Gene symbol-
Locus tagVeis_5020
StrainVerminephrobacter eiseniae EF01-2
Repliconplasmid pVEIS01 [GenBank: NC_008771] [Browse all T4SS(s) in this replicon]
Location [Strand]6261..7304 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDA1WSU9
KEGG IDvei:Veis_5020
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2e-57, Aligned region: 33..323
Protein Sequence: 347 a.a.     [Download]
>gi|121583595|ref|YP_980117.1| type II secretion system protein E [Verminephrobacter eiseniae EF01-2]
MSLTLLSEAVLKPISRVDRSLSVRELMRKFGISEALMANITEFAINRPGSYWIEDSAGWREVPNESLSLS
NLQGLATAIAVFNQKKLDRDNPIASLTLPDGERCQIVLPPACEDGTVSMTIRKPSTSRFSLANYADSGRL
KPVLAGLSEEIQPWEAELLRLAQQGEFVRFFELAVEHHLNIVTVGGTGSGKTTFSKCLIDLYPASRRLFT
IEDAHELTTPKHPNSVHLFFSPTITAKAVLSSCMRMKPDHLFITELRGDETWDYLMALKSGHSGSVTSIH
ANDCRGALYKIGSYIKQSEVGQTLDFDYIMQEVVTTIDVVVFFEKTHLKELYFDPVKKLQLLRGRAS
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|121583590|ref|NC_008771.1|:c7304-6261 Verminephrobacter eiseniae EF01-2 plasmid pVEIS01, complete sequence
ATGTCTTTAACGTTGTTGAGTGAGGCTGTGCTCAAGCCGATAAGCCGGGTTGACCGCTCCCTTTCGGTGC
GGGAGCTGATGCGCAAATTCGGTATCTCCGAAGCCTTGATGGCAAACATCACCGAGTTTGCTATCAACAG
GCCAGGCAGCTACTGGATTGAGGATTCGGCGGGCTGGCGTGAGGTGCCCAATGAATCGTTGTCGCTGTCG
AACCTGCAAGGGTTGGCCACGGCCATAGCCGTGTTCAACCAAAAGAAGCTCGACCGCGACAACCCCATTG
CCTCGCTGACGCTGCCCGATGGGGAGCGTTGCCAAATCGTGTTGCCTCCGGCGTGCGAAGACGGCACCGT
GAGCATGACGATTCGCAAGCCTTCGACCAGCCGGTTTTCGTTGGCCAACTACGCGGATTCCGGGCGGCTC
AAGCCCGTGTTGGCTGGCTTGTCGGAAGAAATTCAGCCCTGGGAGGCTGAATTGCTCCGGTTGGCCCAAC
AAGGCGAGTTTGTGCGCTTCTTTGAGCTGGCGGTAGAGCATCACTTGAACATCGTCACCGTGGGCGGCAC
CGGCTCCGGCAAAACGACGTTTTCCAAGTGCCTGATTGACCTCTACCCGGCCTCGCGCCGCCTGTTCACG
ATTGAGGATGCCCACGAGCTGACCACGCCCAAGCATCCGAACTCGGTACACCTGTTTTTCAGCCCGACCA
TCACCGCCAAAGCAGTGTTGTCGAGCTGCATGCGAATGAAGCCCGATCACCTGTTCATCACTGAGCTGCG
CGGGGATGAAACATGGGACTACCTTATGGCGTTGAAGTCCGGGCATAGCGGCTCTGTGACCTCTATCCAC
GCGAACGATTGCCGGGGTGCGCTCTACAAAATCGGCTCGTACATCAAGCAATCGGAAGTCGGCCAAACGC
TGGATTTCGACTACATCATGCAAGAGGTGGTCACGACCATTGATGTGGTGGTTTTCTTCGAGAAAACCCA
CCTCAAAGAGCTGTACTTTGACCCCGTGAAGAAACTCCAACTGCTGCGAGGCCGCGCGTCATGA
 Primer design