SecReT4
Protein ID: 121583598
T4SS name [ID]VirB [473]
Gene symbol-
Locus tagVeis_5023
StrainVerminephrobacter eiseniae EF01-2
Repliconplasmid pVEIS01 [GenBank: NC_008771] [Browse all T4SS(s) in this replicon]
Location [Strand]9425..10141 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA1WSV2
KEGG IDvei:Veis_5023
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-59, Aligned region: 25..235
Protein Sequence: 238 a.a.     [Download]
>gi|121583598|ref|YP_980120.1| VirB8 family protein [Verminephrobacter eiseniae EF01-2]
MTIKEKPTPKKAAKPARFPQNFAEAAADFEKSKIQEIKRSRKIAWIIAMVSTAICSVSILAFLVALLTRT
EPEPTILQVDKSTGATTVLRSVRDTKDQYDEVVNKYWLAQYVRTCEGYDWFTISEQFEACKLMSDGDVAK
EYSRKVQAPGSPLSVLKDKGKVVVKITSIAFFGETAQVRFTSEKLSASGENVDNSPLQKWIATIAFQFKP
GMMTEQQRLVNPLGFKAATYRVDPEVIK
 
Nucleotide Sequence: 717 bp     [Download]
>gi|121583590|ref|NC_008771.1|:c10141-9425 Verminephrobacter eiseniae EF01-2 plasmid pVEIS01, complete sequence
ATGACCATCAAAGAGAAACCTACGCCCAAAAAGGCCGCAAAGCCTGCCCGGTTTCCACAAAACTTTGCGG
AAGCTGCGGCAGATTTTGAGAAGTCCAAGATTCAGGAAATTAAGCGCTCCCGCAAAATAGCGTGGATTAT
TGCCATGGTGTCCACGGCCATTTGCAGCGTGTCTATTCTTGCGTTCCTGGTCGCACTGCTGACGCGCACG
GAACCTGAACCCACGATTTTGCAGGTTGACAAGAGCACGGGCGCAACAACTGTTTTGCGCTCGGTGCGCG
ACACCAAAGACCAATACGACGAGGTGGTAAACAAGTATTGGTTGGCCCAATACGTCCGCACCTGTGAAGG
TTACGACTGGTTCACCATTTCTGAGCAATTCGAGGCGTGCAAGCTCATGTCTGATGGCGATGTGGCCAAG
GAATATTCGCGCAAGGTGCAAGCGCCTGGCTCGCCCCTGTCGGTGTTGAAGGACAAAGGCAAGGTGGTTG
TGAAAATCACCTCCATTGCGTTTTTCGGTGAAACCGCCCAAGTGCGTTTCACCTCGGAAAAGCTGAGTGC
GAGCGGTGAGAACGTCGATAACTCGCCCCTGCAGAAGTGGATTGCCACCATTGCATTCCAATTCAAGCCC
GGCATGATGACTGAGCAACAACGGCTTGTGAATCCGCTCGGATTCAAGGCCGCAACTTACCGCGTTGACC
CCGAGGTGATTAAATGA
 Primer design