SecReT4
Protein ID: 121593653
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1249
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1327178..1328695 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDA1W5E8
KEGG IDajs:Ajs_1249
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.5e-127, Aligned region: 10..483
Protein Sequence: 505 a.a.     [Download]
>gi|121593653|ref|YP_985549.1| hypothetical protein Ajs_1249 [Acidovorax sp. JS42]
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIIVQEWLKARAEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLNTIQYDSSRSAQCQVSVPQPTDTGWSQSFSTINNQSAKVPVWWAFMHALS
RAVTSASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVADFSRDCYGPARAKLFMQRPQLDEQQMHDVTW
IGSRFFTDTNGYYDTYRSSTPRDDWPYDSNRDAGLAQVSSGGGYPTCRQWWADGSNGLRARLLGQVDPSL
LNRLAGWAGFLSRAEVDDSVIRTIASPRQQKLNQGSVYTDYGGQIDKTLPNIVTRATGDVGMAVGALAAF
PAMDVVRQALPMVLALLKMALVICIPLVLVVGTYDLKTVVTVSVVQFALFFTDFWFQLARWIDSTILDAL
YGWGFGWNRPHTNFDPLVGLNNAFGDMLLMFVTGTMFLVLPTFWVAALGWVGVKAGVIAQNLAVGSKEAR
DSAGSGANKVAGKVL
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1328695-1327178 Acidovorax sp. JS42 chromosome, complete genome
ATGACGCTTTTCACGACCGACTACCTGGAGTACTACCTGACGCTGGTGTCCTGGATCGTCAACAACGGCA
TCTGGGCGGTGCTGGTATCCAGCGGGGTATTCGCGCTGCCTTTCGTCGCCATCATCGTGCAGGAGTGGTT
GAAGGCCCGTGCGGAAGGTGCCGACGAGGGCAATAAAGGCGTGCTGAGCGCCGCCCGCATCGAGAACCGG
GTCTTCGTCGCCATCGTGGTGGTGATGTTCGCCGGCATTCCGTTCATCGACGTGGACCTGAACACCATCC
AGTACGACAGCTCGCGCTCGGCCCAGTGCCAGGTCAGCGTGCCGCAGCCCACGGATACCGGCTGGTCGCA
GTCCTTCAGCACCATCAACAACCAGTCGGCGAAGGTGCCCGTCTGGTGGGCGTTCATGCATGCACTCTCG
CGCGCCGTCACGAGCGCCTCGGTGGCGGCGATCCCGTGTGGCACGGACCTGCGGCAGATGCGCATGGAGA
TCGACGCCACGCGCATCGATGACCCGGTGCTGGCTCAGGAAGTAGCGGATTTCTCGCGGGATTGCTATGG
GCCTGCACGGGCCAAATTGTTCATGCAGCGCCCTCAGCTCGATGAGCAGCAGATGCACGACGTGACCTGG
ATCGGATCGCGGTTCTTCACCGACACGAACGGCTACTACGACACGTACCGTTCCAGCACGCCGCGCGATG
ACTGGCCCTATGACAGCAACCGCGACGCCGGGCTGGCTCAGGTATCCAGTGGCGGTGGCTACCCGACCTG
CAGGCAATGGTGGGCTGATGGCAGCAATGGCCTGCGGGCACGCCTGCTGGGACAGGTGGACCCGAGCCTG
CTCAATCGGCTGGCGGGCTGGGCCGGGTTCCTGAGCCGGGCCGAGGTGGACGACTCGGTGATCCGCACCA
TCGCGTCGCCGAGGCAGCAGAAGTTGAACCAGGGCAGCGTCTATACGGACTACGGCGGCCAGATCGACAA
GACCTTGCCGAACATCGTGACGCGGGCCACGGGAGACGTTGGGATGGCAGTCGGCGCGCTTGCGGCATTT
CCCGCCATGGACGTTGTGAGACAGGCCCTGCCCATGGTGCTCGCCTTGCTCAAGATGGCGCTGGTCATCT
GCATCCCGCTCGTGCTGGTTGTGGGCACCTATGACCTGAAGACGGTCGTCACGGTCAGCGTCGTGCAGTT
CGCGCTGTTCTTCACGGACTTCTGGTTTCAGCTTGCGCGCTGGATCGATTCGACGATCCTGGACGCACTT
TATGGCTGGGGGTTCGGCTGGAACCGGCCGCACACCAATTTCGACCCGTTGGTAGGACTGAACAACGCCT
TCGGTGACATGCTCCTGATGTTCGTCACGGGCACGATGTTTCTGGTCCTGCCGACGTTTTGGGTCGCTGC
CTTGGGGTGGGTCGGAGTTAAGGCTGGGGTGATTGCTCAGAACCTTGCTGTCGGCTCCAAGGAAGCGCGT
GATAGCGCCGGGTCAGGTGCAAACAAGGTAGCCGGCAAGGTTCTGTGA
 Primer design