SecReT4
Protein ID: 121593655
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1251
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1329066..1330460 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA1W5F0
KEGG IDajs:Ajs_1251
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 464 a.a.     [Download]
>gi|121593655|ref|YP_985551.1| hypothetical protein Ajs_1251 [Acidovorax sp. JS42]
MKRPEPMNLSAKACYLLRPTALAGTLALVCGLAWAQVGYQNSGPVIGDDVMYSIGGGSAVSMGRAAGMRS
IGVGLGWNSNLICGDMSIQTTLRNQLNGITNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNLLTNG
VLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAEGMALRDAVGSNDAVSAVEQAETRRGNDGVPWVG
GSNAGGAGQSAIRVVGDVTRAGYNLVNGRGVTDTSSIALASCASLSCQTWTSPQQATEWATRVLGEQVQR
TCDSCTKTETVPGVGLTPLIQEEYEAKLEVLQELVSGVRNTTFENLREAGSTSLPITRGVIEALRDEPDQ
DLLARRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVEAVNHESDTLDREIRNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGVRP
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1330460-1329066 Acidovorax sp. JS42 chromosome, complete genome
ATGAAGCGTCCTGAACCGATGAACCTTTCCGCCAAGGCGTGCTACTTGCTGCGCCCGACGGCGCTGGCCG
GCACGCTCGCTCTGGTCTGCGGCCTGGCGTGGGCGCAGGTCGGATACCAGAACAGCGGCCCCGTCATTGG
CGATGACGTCATGTACTCGATCGGAGGCGGCAGCGCGGTGTCCATGGGCCGCGCGGCTGGCATGCGCTCC
ATCGGGGTCGGCTTGGGGTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCCAGACCACGCTGCGCA
ACCAGCTCAACGGCATCACGAACGGCTTCCAGCAGATCATGAGCAACGTGATCCAGAGCGCCACCAGCGC
GGTGGCGTCCCTGCCGGCGCTGATCATTCAGCGCGCCGATCCCGGCCTGTACAACCTGCTGACCAACGGC
GTGCTGCAGGCGCGGCTGGACTTCGACCGCTCCAAGCTGACGTGCCGCGCGATGGCCGAGAAGATGGCCG
AGACGGCGGGCGGCCAGCTTGGCTGGAGCCAGATGGCCGAAGGCATGGCCCTGCGTGACGCGGTTGGCAG
CAACGATGCCGTTTCGGCCGTCGAGCAGGCTGAGACGCGCCGCGGCAACGACGGCGTTCCCTGGGTGGGC
GGCAGCAATGCCGGTGGCGCAGGCCAGTCCGCCATTCGGGTGGTCGGCGACGTCACCCGCGCGGGCTACA
ACCTGGTCAACGGGCGCGGCGTGACGGACACATCCTCCATCGCGCTCGCCAGTTGCGCGAGCCTGTCCTG
CCAGACCTGGACGTCGCCGCAGCAGGCGACCGAATGGGCCACCCGGGTCCTCGGGGAACAGGTGCAGCGC
ACGTGCGATTCCTGCACCAAGACCGAGACGGTGCCCGGCGTCGGGCTGACGCCGCTGATCCAGGAGGAGT
ACGAAGCCAAACTGGAAGTCTTGCAGGAACTGGTTTCCGGCGTGCGCAACACCACCTTCGAGAACTTGCG
CGAGGCCGGCAGCACGTCGCTGCCGATCACGCGCGGCGTCATCGAGGCGCTGCGCGACGAGCCGGACCAG
GACCTGCTGGCGCGGCGCCTTGCGTCCGAGGTGGCGCTGTCGTCGGTGCTGGAGAAGGCCTTGTTGCTCC
AGCGCACGCTGCTCACGGGAAAGAAGGAGCCCAACGTGGCGGCCAACGAGTTGGCGGTCGAGGCTGTGAA
CCACGAGAGCGACACGCTCGACCGGGAGATCCGCAACCTGAAAACGGAGCTGGAGCTGCGCCGCGAGCTG
GCGAACAACTCGCCGATGGCGATCATCCAGCGCCATGGTACGCGCGCGGCCGGCTCGCGCGGCATCTACG
AGGGCGATCCGGTGCCCGACCGCCTCGACCAGTTGCAGAAGGGCAATCCGGGAGTCAGGCCATGA
 Primer design